Peptides

<p>Tripeptide-41 (CG-Lipoxyn) is a bioactive peptide known for its ability to reduce fat accumulation.</p>

<p>SLLK, Control Peptide for TSP1 Inhibitor (TFA) is a control peptide for LSKL, which is a Thrombospondin (TSP-1) inhibitor.</p>

<p>Elamipretide acetate (MTP 131), a small tetrapeptide, targets mitochondria to reduce toxic species and stabilize cardiolipin.</p>

<p>OVA Peptide (323-339) is an Ovalbumin epitope crucial for hypersensitivity in BALB/c mice.</p>

<p>CBD3063 is a CRMP2-based peptidomimetic small molecule that can regulate Cav 2.2 and can be used to study neurological diseases.</p>

PalMitoyl Tripeptide-1 hydrochloride (PalMitoyl Tripeptide-1 hydrochloride (147732-56-7 Free base)) has effects on the synthesis of collagen, fibronectin and hyaluronic acid in human skin fibroblasts, and can be used in the preparation of anti-aging cosmetics.

<p>PD-1/PD-L1 binder, Kd 0.51 μM; blocks interaction in flow cytometry at 1 mg/mL; inhibits tumors, extends mouse survival.</p>

<p>Pam2CSK4 TFA (PUL-042 TFA) is a potent dual agonist of TLR2 and TLR6, a peptide that mimics bacterial lipoproteins.Pam2CSK4 TFA promotes platelet aggregation, and can be used to study the effects of lipoproteins on the periodontium.</p>

<p>Darobactin is an antibiotic effective against critical Gram-negative pathogens, demonstrating activity both in vitro and in animal infection models [1].</p>

<p>MTP 131 (acetate) is a small mitochondrially-targeted tetrapeptide.</p>

<p>Elamipretide (SS-31, MTP-131, Bendavia) is a mitochondria-focused peptide that curbs toxic ROS and stabilizes cardiolipin.</p>

<p>Peptide Ac-CERDKENPNQYNYVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CPSSHSSLTERHKILHRLLQEGSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Galanin is a widely distributed neuropeptide in the central nervous system, peripheral regions and endocrine system. Galanin has a role in energy homeostasis- central injections of galanin to the amygdala led to food intake in rats. Galanin also acts in the CNS to inhibit neurotransmitter release, such as acetylcholine. Galanin has been implicated in numerous neurological conditions, including Alzheimer's disease, depression, and epilepsy.Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of potassium ions.The galanin active fragment 1-16 has been identified as a highly potent agonist for the galanin receptors.  These have become a basis for galanin-based peptides, which are neuroactive. These are being investigated as a potential source for anticonvulsant neuropeptides as a therapeutic for conditions such as epilepsy. A library of galanin fragments has allowed screening of their properties to be assessed and used to generate chimeric peptides. Galanin fragments have different affinities for GalR receptors however, the N-terminal 1-16 have been shown to have a conserved affinity for the receptors. This galanin (2-13) peptide is provided in the acidic form. The amide form is also available in our catalogue.</p>

<p>Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CKRRKIDDYFAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FNAVLTNPQGDYDTSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KDLLEQKRAAVDTYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Fluor-SDKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IGEVDVEQHTLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SKISASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SSLLDVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVGGEDAKPGQFPWQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GSNFQLDQLQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Protected amino acid</p>

<p>Peptide H-GTYLTDETHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QDGNEEM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PTAPPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-KDGIVNGVKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AHQLAIDTYQEFEETYIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide For-MMYALF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ASANLAATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SAYVSYDVQK^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Myr-RLRYRNKRIWRSAYAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Spike S peptide is a peptide pool made of 15-mer peptides with 11–amino acid (aa) overlap, covering the complete sequence of the Spike S protein.</p>

<p>Peptide H-ESDTSYVSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-DITPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YPIPPPDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVDALGNAIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-MRL^LPLLAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CISGDSLISLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TLYSSSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-R^TPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YFQATTLGLPLEISK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-QGFGNVATNTDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AR^PALEDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>

<p>Peptide H-YALYDATYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lysine peptide (Ac RFAAKAA COOH) is used in combination with cysteine peptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>

<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YNWNSFGLRY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Cy5-GSARAEVHLRKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VFSNGADLSGVTEEAPLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5TAMRA-GRKKRRQRRRCDMAEHMERLKANDSLKLSQEYESI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TDYNASVSVPDSSGPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-L^EVFYNGAWGTV^GK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-GKPIPNPLLGLDST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-R^VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VTSIQDWVQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-LPETGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>MeO-Suc-Arg-Pro-Tyr-pNA is a peptide that is used as an enzyme substrate for chymotrypsin and other proteases. It contains the amino acid sequence of methoxy (MeO), succinyl (Suc), arginine (Arg), proline (Pro), tyrosine (Tyr) and p-nitroanilide (pNA). The MeO group on the N-terminus is important for inhibiting proteolysis by chymotrypsin. This peptide is also a substrate for chymotrypsin-like enzymes.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LLVPANEGDPTETLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>SK channel blocker</p>

<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LQDAGVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IP^TTFENGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-LLM-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-TQARMVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-NSLFEYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ELLRSFFYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-CRSPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SGVQQLIQYYQDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RPPGF^SPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LFDSLTLLASGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VLADEFIIPGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-NAPVISPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLAQTTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SGRKSSKMQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TTLTAAITTVLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLDLLEGLTGQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DFLAGGIAAAISK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GVALQTMKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AFLTVKKQM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease. TFA salt; 95%.</p>

<p>Peptide H-EDSFLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AVAVYADQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLRFLYEG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GSFPWQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FNAVLTNPQGDYDTSTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CTPDQGKADPYQYVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IYVDDGLISLQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RPHERNGFTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLKRRRCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CKMQQNGYENPTYKFFEQMQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLLNNQFGTM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALNRTSSDSALHRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALNRTSSDSALHRRR-OH include the following: Enhanced activation of cellular AMPK by dual-small molecule treatment: AICAR and A769662 S Ducommun , RJ Ford, L Bultot - American Journal , 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013</a> Characterization of WZ4003 and HTH-01-015 as selective inhibitors of the LKB1-tumour-suppressor-activated NUAK kinases S Banerjee , SJ Buhrlage, HT Huang , X Deng - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/457/1/215/46906" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/457/1/215/46906</a> Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1betaMYPT1 phosphatase complex and the SCFbetaTrCP E3 ubiquitin ligase S Banerjee , A Zagorska, M Deak - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/461/2/233/46874" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/461/2/233/46874</a> Inhibition of SIK2 and SIK3 during differentiation enhances the anti-inflammatory phenotype of macrophages NJ Darling , R Toth, JSC Arthur , K Clark - Biochemical Journal, 2017 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/474/4/521/49590" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/474/4/521/49590</a> Comparison of the specificity of Trk inhibitors in recombinant and neuronal assays KJ Martin, N Shpiro, R Traynor, M Elliott , JSC Arthur - Neuropharmacology, 2011 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0028390811001389" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0028390811001389</a> Enhanced activation of cellular AMPK by dual small GR Kemp, K Sakamoto - 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013</a> The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes E Henriksson, HA Jones, K Patel , M Peggie - Biochemical , 2012 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/444/3/503/46279" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/444/3/503/46279</a></p>

<p>Peptide H-QMVQQFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TSYQVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AAGTVFTTVEDLGSKILLTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KGLGISYGRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FNWYVDDVEVHNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WHWLQLKPGQPMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WHWLQLKPGQPMY-OH include the following: Position one analogs of the Saccharomyces cerevisiae tridecapeptide pheromone YL Zhang, HUIFEN LU, JM Becker - The Journal of peptide , 1997 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x</a> Synthesis, Biological Activity, and Conformational Analysis of Peptidomimetic Analogues of the Saccharomyces cerevisiae alpha-Factor Tridecapeptide YL Zhang, HR Marepalli, H Lu, JM Becker - Biochemistry, 1998 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi980787u" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi980787u</a> Receptor in Saccharomyces cereuisiae SK RathsSQ, M BeckerSII - researchgate.net<a href="https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf" target="_blank" rel="noreferrer noopener">https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf</a> Peptide analogues compete with the binding of alpha-factor to its receptor in Saccharomyces cerevisiae. SK Raths, F Naider, JM Becker - Journal of Biological Chemistry, 1988 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0021925819778405" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0021925819778405</a> Binding of fluorinated phenylalanine alpha-factor analogues to ste2p: Evidence for a cation-Ï€ binding interaction between a peptide ligand and its cognate G protein S Tantry, FX Ding, M Dumont , JM Becker, F Naider - Biochemistry, 2010 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi100280f" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi100280f</a> Position 13 analogs of the tridecapeptide mating pheromone from Saccharomyces cerevisiae: design of an iodinatable ligand for receptor binding S Liu, B Arshava, F Naider, LK Henry - Journal of Peptide , 2000 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x</a> Ab initio calculations on Pro-Ala and Pro-Gly dipeptides O Antohi, F Naider, AM Sapse - Journal of Molecular Structure , 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0166128095043608" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0166128095043608</a> Structural requirement tryptophan1,3 of tridecapeptide mating pheromone of Saccharomyces cerevisiae NJ Hong, YA Park, JW Lee - : Proceedings of the 1st International Peptide , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf</a> Studies on conformational consequences of i to i+ 3 side-chain cyclization in model cyclic tetrapeptides MH RAO, WEI YANG, H JOSHUA - Journal of Peptide , 1995 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x</a> Specificity characterization of the alpha-mating factor hormone by Kex2 protease MA Manfredi, AA Antunes, LOP Jesus, MA Juliano - Biochimie, 2016 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0300908416302358" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0300908416302358</a> Control of the yeast cell cycle with a photocleavable alpha-factor analogue LL Parker , JW Kurutz, SBH Kent - Chemie (International ed , 2006 - ncbi.nlm.nih.gov<a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/" target="_blank" rel="noreferrer noopener">https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/</a> Matrix-assisted laser desorption/ionization mass spectrometry peptide sequencing utilizing selective N-terminal bromoacetylation J Song, HJ Kim - Analytical biochemistry, 2012 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269711007548" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269711007548</a> Solution Structures of i to i + 3 Cyclized Model Peptides: Building Blocks Mimicking Specific Conformations HR Marepalli, O Antohi, JM Becker - Journal of the American , 1996 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/ja954217i" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/ja954217i</a> Highly active analogs of alpha-factor and their activities against Saccharomyces cerevisiae HJ Ahn, EY Hong, DH Jin, NJ Hong - Bulletin of the Korean Chemical , 2014 - Citeseer<a href="https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2" target="_blank" rel="noreferrer noopener">https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2</a> Identification of residue-to-residue contact between a peptide ligand and its G protein-coupled receptor using periodate-mediated dihydroxyphenylalanine cross GKE Umanah, L Huang , F Ding, B Arshava - Journal of biological , 2010 - ASBMB<a href="https://www.jbc.org/article/S0021-9258(20)60639-1/abstract" target="_blank" rel="noreferrer noopener">https://www.jbc.org/article/S0021-9258(20)60639-1/abstract</a> Cross-linking of a DOPA-containing peptide ligand into its G protein-coupled receptor GKE Umanah, C Son , FX Ding, F Naider - Biochemistry, 2009 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi802061z" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi802061z</a> Structural requirements for alpha-mating factor activity G Houen, O Nielsen, C Flanagan - FEBS letters, 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0014579396007260" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0014579396007260</a> The alpha-factor mating pheromone of Saccharomyces cerevisiae: a model for studying the interaction of peptide hormones and G protein-coupled receptors F Naider, JM Becker - Peptides, 2004 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0196978104002943" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0196978104002943</a> Studies on the yeast alpha-mating factor: A model for mammalian peptide hormones F Naider, J Gounarides, CB Xue - Biopolymers , 1992 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407</a> Probing the Binding Site of a Heptahelical Peptide Pheromone Receptor Using Photoaffinity Labelling, Site-Directed Mutagenesis and Spectroscopic Approaches F Naider, BK Lee, LK Henry, F Ding, SK Khare - Peptides: The Wave of , 2001 - Springer<a href="https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409" target="_blank" rel="noreferrer noopener">https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409</a> Biophysical studies on a transmembrane peptide of the Saccharomyces cerevisiae alpha-factor receptor F Naider, B Arshava, H Xie, S Liu, WY Eng - Peptides for the New , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf</a> Characterization of novel peptide agonists of the alpha mating factor of Saccharomyces cerevisiae EG Siegel, R Gunther, H Schafer, UR Fölsch - Analytical , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269799942896" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269799942896</a> Antagonistic and synergistic peptide analogs of the tridecapeptide mating pheromone of Saccharomyces cerevisiae E Eriotou-Bargiota , CB Xue, F Naider, JM Becker - Biochemistry, 1992 - ACS Publications<a href="https://pubs.acs.org/doi/pdf/10.1021/bi00117a036" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/pdf/10.1021/bi00117a036</a> Probing the functional conformation of the tridecapeptide mating pheromone of Saccharomyces cerevisiae through study of disulfide-constrained analogs CHUB XUE, A MCKINNEY, HUIFEN LU - journal of peptide , 1996 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x</a> Spiegel, zyxwvutsrqponm B Molitoris, AC Alfrey, RA Harris, FR Simon - Am. J. Physiol, 1985 - academia.edu<a href="https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf" target="_blank" rel="noreferrer noopener">https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf</a> Long-distance rotational echo double resonance measurements for the determination of secondary structure and conformational heterogeneity in peptides B Arshava, M Breslav, O Antohi, RE Stark - Solid State Nuclear , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0926204099000181" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0926204099000181</a> Synthesis of biologically active analogs of the dodecapeptide alpha-factor mating pheromone of Saccharomyces cerevisiae A EWENSON, S MARCUS - Journal of Peptide , 1990 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x</a></p>

<p>Peptide H-RPMTYKAAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FEGLTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GVNDNEEGFFSAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Prostaglandin A1 is a bioactive lipid, which is derived from arachidonic acid through enzymatic pathways. It functions as a signaling molecule with various biological activities, influencing vascular tone, inflammation, and smooth muscle activity. Prostaglandins are a subset of eicosanoids, which are synthesized from essential fatty acids found within phospholipid membranes of cells.</p>

<p>Peptide H-FLCEILRSMSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GEPGDAGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ASGPGGGAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QLVFGIEVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GGLPFSLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DYKDDDDKPAYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NGSLQCRICI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DLWQWRKSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FPLTSFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lugdunin is a synthetic antibiotic that has been shown to inhibit the growth of bacteria by binding to the cell membrane. This binding causes a change in membrane potential, leading to inhibition of bacterial growth and death. Lugdunin is effective against Staphylococcus aureus, including methicillin-resistant strains, and has been found to be safe for use in humans. It is also active against other Gram-positive bacteria such as Streptococcus pneumoniae and Enterococcus faecalis. The enantiomer of lugdunin does not have antibacterial activity.</p>

<p>Iberiotoxin a synthetic scorpion toxin sourced from the Buthus tamulus scorpion, has disufide bonds formed between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. This prodict can be used as a Ca2+-Activated K+ Channel Blocker (Maxi-K+ Channel Blocker). This peptide can be used in pharmacological studies to investigate the effects of Iveriotoxin on various ion channels and receptors. This product is available as a 0.1mg vial.</p>

<p>SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.<br>SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 395-430 (Biotin-LC) peptide</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THPO antibody, catalog no. 70R-6200</p>

<p>For Protein Identification and Quantitation</p>

<p>IL-1α is a cytokine protein that has been shown to be involved in the immune system. IL-1α is an activator of the receptor and is also a ligand for it. The protein has been shown to activate ion channels, which are proteins that allow ions to pass through either by diffusion or by facilitated transport. This activation causes cells to produce more hydrogen ions, which leads to an increase in the acidity of the cell. IL-1α has also been shown to inhibit cell proliferation and induce apoptosis.</p>

<p>Methoxytrityl-S-dPEG®4 Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Methoxytrityl-S-dPEG®4 Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Bovine Serum Albumin (BSA) is a protein that is used in the pharmaceutical industry as a research tool and an immunological reagent. BSA can be used to bind, stabilize, and prevent denaturation of other proteins in the laboratory. It has been shown to inhibit ion channels and ligand-gated ion channels, which are important for membrane potentials. BSA is also an activator of receptor tyrosine kinases, which are involved in cell signaling pathways.</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Peroxiredoxin-1 is a protein that belongs to the peroxiredoxin family. It is a redox-active protein that can reduce hydroperoxides and organic hydroperoxides. Peroxiredoxin-1 has been shown to be an activator of ion channels, receptors, and ligands. It is used as a research tool for studying the interactions between proteins and peptides.</p>

<p>Custom research peptide; min purity 95%.</p>