Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30340 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Pal-LPQDKEYYKVKEP-OH
<p>Peptide Pal-LPQDKEYYKVKEP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>R8- BBC3 amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-YNGIITETIK^-OH
<p>Peptide H-YNGIITETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KIQMK-NH2
<p>Peptide Ac-KIQMK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-FLEAIG-NH2
Peptide Ac-FLEAIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MPRHSRAKRAPRPSAC-NH2
Peptide H-MPRHSRAKRAPRPSAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALQASALNAWR^-OH
Peptide H-ALQASALNAWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQDAYGGWANR^-OH
Peptide H-LQDAYGGWANR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H2N-Gly-Pro-Leu-Gly-Val-Arg-Gly-Cys-COOH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C31H55N11O9S1Molecular weight:757.9 g/molH-CLAVEEVSL^-OH
Peptide H-CLAVEEVSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSFFLYSK^LTVD-OH
Peptide H-GSFFLYSK^LTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYPSDIAVEWESNGQPENNYK-OH
<p>Peptide H-GFYPSDIAVEWESNGQPENNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDLLEGLTGQK^-OH
<p>Peptide H-LLDLLEGLTGQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FKAFKAFKAFKA
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C72H106N16O13Molecular weight:1,403.71 g/molH-ARTKQTARKSTG-NH2
<p>Peptide H-ARTKQTARKSTG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MPSKSASLRHTEAC-NH2
<p>Peptide H-MPSKSASLRHTEAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVVVGADGV^-OH
<p>Peptide H-KLVVVGADGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-EEYHQTTEKNSP-NH2
Peptide Biot-EEYHQTTEKNSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGGGDLTLGLEPSEEEAPR^-OH
<p>Peptide H-SGGGDLTLGLEPSEEEAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYNSEESRPYTNK^-OH
<p>Peptide H-LYNSEESRPYTNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYPGLTSYLVR^-OH
<p>Peptide H-SYPGLTSYLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>E75, Her - 2/neu (369 - 377)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C50H78N10O11Molecular weight:995.24 g/molBiot-PPAHGVTSAPDTRPA-NH2
Peptide Biot-PPAHGVTSAPDTRPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPLQLER^-OH
<p>Peptide H-GPLQLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Nanog
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-YSSLAEAASK^-OH
<p>Peptide H-YSSLAEAASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGSVIDQSR^-OH
<p>Peptide H-SGSVIDQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQLANDVVL^-OH
Peptide H-AQLANDVVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-13
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,603.8 g/molCys-Kemptide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C35H66N14O10S1Molecular weight:875.1 g/molSARS-CoV-2 Antigen Peptide NCAP (ILLNKHID)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C44H76N12O12Molecular weight:965.22 g/molBiot-MHRSDLMSAAVR-OH
<p>Peptide Biot-MHRSDLMSAAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFGSPNR^-OH
<p>Peptide H-SFGSPNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDSALYLGSR^-OH
<p>Peptide H-VDSALYLGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTVAGLAGK^-OH
<p>Peptide H-VTVAGLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSPVLIDFFEDTER^-OH
<p>Peptide H-DSPVLIDFFEDTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-MEEVD-OH
<p>Peptide Ac-MEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Trp-Ile-Arg
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C23H35N7O4Molecular weight:473.57 g/molH-LPDA^TPTELA^K^-OH
<p>Peptide H-LPDA^TPTELA^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 132 (AELEGVWQPAAQPKR)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,679.9 g/molH-VVVGARGVGK^-OH
<p>Peptide H-VVVGARGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASGFTFMSSAVQWVR^-OH
<p>Peptide H-ASGFTFMSSAVQWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLQEINAYIGHSVEK^-OH
<p>Peptide H-NLQEINAYIGHSVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CYFQNCPR^G-OH
<p>Peptide H-CYFQNCPR^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQAAVGTSAAPV^PSDNH-OH
<p>Peptide H-VQAAVGTSAAPV^PSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYGAFSR^-OH
<p>Peptide H-LLIYGAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 135 (PKRRRHRQDALPGPC)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,787.1 g/molHemoglobin β chain [133-146]
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C66H104N20O17Molecular weight:1,449.6 g/molBiot-KKKSPGEYVNIEFG-NH2
<p>Peptide Biot-KKKSPGEYVNIEFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTPTAENPEYLGL^DVPV-OH
<p>Peptide H-GTPTAENPEYLGL^DVPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIYSTDYYR^-OH
<p>Peptide H-DIYSTDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5FAM-HQSYVDPWMLDH-OH
<p>Peptide 5FAM-HQSYVDPWMLDH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-23/aa89 - 103
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,824.1 g/molSIVmac239 - 8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,845.2 g/molAc-AGRSL-NH2
<p>Peptide Ac-AGRSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LADFADALEHPLR^-OH
Peptide H-LADFADALEHPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGQEIEVRPGIVSK^-OH
<p>Peptide H-VGQEIEVRPGIVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>S961 TFA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C211H297N55O71S2Molecular weight:4,804.13 g/molH-TPAYYPNAGLIK^-OH
<p>Peptide H-TPAYYPNAGLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YARAAARQARAKALARQLGVAA-NH2
<p>Peptide H-YARAAARQARAKALARQLGVAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVLTIDKK^-OH
<p>Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2
CAS:<p>This is a synthetic peptide that mimics the endogenous human epidermal growth factor (EGF) and binds to the toll-like receptor. It has been shown to stimulate physiological function in experimental models of bowel disease and cardiac disease, as well as cancer tissues. The peptide also binds to the guanine nucleotide-binding protein, polymerase chain reaction, and inflammatory bowel disease genes. In vivo studies have confirmed that this peptide enhances the production of EGF in maternal blood and stimulates squamous carcinoma growth in an animal model.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.78 g/molH-YEINVLR^-OH
<p>Peptide H-YEINVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(D-Ala1)-Peptide T amide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C35H56N10O15Molecular weight:856.89 g/molH-KQL^ATKAAR-OH
Peptide H-KQL^ATKAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTTCVNWNQY-NH2
<p>Peptide H-NTTCVNWNQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,852.2 g/molBax-BH3
<p>Peptide Bax-BH3 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C77H136N22O27SMolecular weight:1,834.13 g/molTAPI-1
CAS:<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>Formula:C26H37N5O5Purity:Min. 95%Molecular weight:499.60 g/molSIVmac239 - 28
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,636.9 g/molγ ABU-GSDALDDFDLDML-OH
Peptide gamma ABU-GSDALDDFDLDML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPENYPNAGLTR^-OH
Peptide H-TPENYPNAGLTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 131
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,310.5 g/molAc-RAHEEIYHFFFAKKK-NH2
<p>Peptide Ac-RAHEEIYHFFFAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-GLLKLASPELERL-NH2
<p>Peptide Biot-GLLKLASPELERL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hemorphin-7
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C49H64N12O11Molecular weight:997.12 g/molLCBiot-PRIGGQRELKKITE-OH
<p>Peptide LCBiot-PRIGGQRELKKITE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LCTPSR-NH2
<p>Peptide Ac-LCTPSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>VP1 14-22 (HLA-B*07:02)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-SPYVITGPGVVEYK^-OH
<p>Peptide H-SPYVITGPGVVEYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIQEILTQVK^-OH
Peptide H-KIQEILTQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTGEVLDILTR^-OH
Peptide H-VTGEVLDILTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[pGlu3]-Amyloid-β Protein (3-42) (Human)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:4,309.9 g/molNeuromedin B (porcine)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C52H73N15O12SMolecular weight:1,132.3 g/molH-ALEKDY-NH2
<p>Peptide H-ALEKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Thr-Val-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C18H27N3O5Molecular weight:365.42 g/molCMVpp65 - 10 (HETRLLQTGIHVRVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,746 g/molSIVmac239 - 59
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,479.5 g/molDOTA-LRELHLNNN-OH
Peptide DOTA-LRELHLNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MBP (1 - 11), mouse
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C53H95N21O18Molecular weight:1,314.48 g/molRhod-VPMLKE-OH
<p>Peptide Rhod-VPMLKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GRKKRRQRRRPP-NH2
Peptide H-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GV^YDGEEHSV^-OH
Peptide H-GV^YDGEEHSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFEERN-NH2
Peptide H-TFEERN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-64
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,795.2 g/molH-IGEGTYGVVYK^-OH
<p>Peptide H-IGEGTYGVVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2
<p>H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is a peptide that was originally isolated from the venom of the Brazilian spider, Phoneutria nigriventer. This peptide has been shown to have anti tumor activity in mice by targeting and binding to the tumor cells. H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is also a cell penetrating peptide (CPP) that can penetrate into the cell and disrupts cancer cell growth. It is also a disulfide rich peptide with RGD sequence which binds to integrins on the surface of tumor cells and induces apoptosis.</p>Formula:C35H58N14O13S2Purity:Min. 95%Molecular weight:947.07 g/molNR-Box 2 Peptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,574.9 g/molAc-CSWYNGHRPEPGLG-NH2
<p>Peptide Ac-CSWYNGHRPEPGLG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASMTNMEL^M-OH
<p>Peptide H-ASMTNMEL^M-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDSLAYGLR^-OH
<p>Peptide H-GDSLAYGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-FKNIVTPRTPPPSQG-OH
Peptide Biot-FKNIVTPRTPPPSQG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.ZnT-8 93-101 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-LLSLTYDQK^-OH
Peptide H-LLSLTYDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELLK^-OH
<p>Peptide H-QTALVELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQEVAGSLIFR^-OH
<p>Peptide H-IQEVAGSLIFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALVDQVIGSR^-OH
<p>Peptide H-ALVDQVIGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AATVGSLAGQPLQER^-OH
Peptide H-AATVGSLAGQPLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFGFPVHYTDVSNMSR^-OH
<p>Peptide H-VFGFPVHYTDVSNMSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-GGSEGKSSGSGSESKSTGGS-NH2
<p>Peptide LCBiot-GGSEGKSSGSGSESKSTGGS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISAPNVDFNLEGPK^-OH
<p>Peptide H-ISAPNVDFNLEGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-59
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,520.6 g/molH-FAQTVMTSR^-OH
<p>Peptide H-FAQTVMTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RACGAP1
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>5Fam-CRGDK-OH
Peptide 5Fam-CRGDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLILAFSR^-OH
<p>Peptide H-LLILAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DQVILLNK^-OH
<p>Peptide H-DQVILLNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPELQAEAK^-OH
Peptide H-SPELQAEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VL^IGLDLLYGELQDSDDF-OH
Peptide H-VL^IGLDLLYGELQDSDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CERFLGTSEATKL-OH
<p>Peptide Ac-CERFLGTSEATKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NYGSSWETPSNQC-NH2
Peptide Ac-NYGSSWETPSNQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 199
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:2,070.4 g/molH-YSPGGTPTAIK^-OH
<p>Peptide H-YSPGGTPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGVAPDHPEVK^-OH
Peptide H-FGVAPDHPEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFRRRL-NH2
<p>Peptide H-TFRRRL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-PTTDSTTPAPTTK-NH2
<p>Peptide Biot-PTTDSTTPAPTTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CKLQHVYKRLAMGDNVL-OH
<p>Peptide Ac-CKLQHVYKRLAMGDNVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GALALAQAVQR^-OH
Peptide H-GALALAQAVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDLLDR^-OH
<p>Peptide H-ALDLLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DALSSVQESQVAQQ^AR-OH
<p>Peptide H-DALSSVQESQVAQQ^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-PGLPLSLQNG-NH2
<p>Peptide Ac-PGLPLSLQNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 envelope - 86
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:2,478 g/molBoc-Glu(OBzl)-OH
CAS:<p>Boc-Glu(OBzl)-OH is a peptide that inhibits the enzyme adenylate kinase. It binds to the ATP binding site on the enzyme and blocks access of the substrate, ADP, to its catalytic site. This prevents ATP from being converted into AMP, which is needed for cellular energy production. Boc-Glu(OBzl)-OH has been used in research as an inhibitor in cell biology and pharmacology studies.<br>The purified product is supplied at high purity with low endotoxin levels.</p>Formula:C17H23NO6Purity:Min. 95%Molecular weight:337.37 g/molHXB2 gag NO-81
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,670 g/mol[Dap3]-Ghrelin (Human, Rat, 1-5)
CAS:<p>Dap3-Ghrelin is a Ghrelin related peptide and is the active fragment of Ghrelin that binds to Ghrelin receptors with high affinity and activates the same signaling pathway as endogenous ghrelin. This product can be used in the study of obesity as Ghrelin has been shown to be a hormone that stimulates appetite and meal initiation. It could also play a role in gaining a further understanding into diabetes as Ghrelin has been found to stimulate insulin release.</p>Formula:C31H51N7O7Purity:Min. 95%Molecular weight:633.79 g/molH-SSFTVQDLKPFTEYVFR^-OH
<p>Peptide H-SSFTVQDLKPFTEYVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQLTPLI^K-OH
<p>Peptide H-EQLTPLI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTSIQ^D^WV^Q^K^-OH
<p>Peptide H-VTSIQ^D^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLQEAAEER^-OH
<p>Peptide H-GLQEAAEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGV^ITSPDFPNPYP^K^-OH
<p>Peptide H-TGV^ITSPDFPNPYP^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVSGTLIGLEFIR^-OH
<p>Peptide H-GTVSGTLIGLEFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-QYTSIHHGVVEVD-OH
<p>Peptide LCBiot-QYTSIHHGVVEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNWNSFGLR^F-NH2
<p>Peptide H-YNWNSFGLR^F-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELVEPLTPSGEAPNQALLR^-OH
Peptide H-ELVEPLTPSGEAPNQALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-WSASALAKI-OH
<p>Peptide Ac-WSASALAKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-V^T^SGSTST^SR^-OH
Peptide H-V^T^SGSTST^SR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-K^DMQLGR-OH
<p>Peptide H-K^DMQLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 26
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,844 g/molLCBiot-GVSVRGRGAAPPPPPVPRGRGVGP-OH
<p>Peptide LCBiot-GVSVRGRGAAPPPPPVPRGRGVGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 72
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,736.9 g/molDnaK (HSP70) E.coli (recombinant)
<p>DnaK is a protein that is found in the cytoplasm of bacteria and helps to maintain the homeostasis of cells. It has been shown to be an inhibitor of peptide binding to receptor sites and can be used as a research tool for identifying ligands and receptors. DnaK binds to the receptor site on a cell membrane, preventing the binding of a toxin or other harmful substance. This protein also interacts with Ligand, which is a molecule that binds to specific sites on the surface of cells and triggers an effect inside the cell. DnaK has been studied extensively for its role in ion channel activity, antibody production, and cell cycle progression.</p>Purity:>85% By Sds-PageSIVmac239 envelope - 84
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:2,140.4 g/molAc-SLSRFSWGA-NH2
<p>Peptide Ac-SLSRFSWGA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Dynorphin A (1-8)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C46H72N14O10Molecular weight:981.17 g/molFluor-YGGFMRGL-OH
<p>Peptide Fluor-YGGFMRGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQVFDVGPR^-OH
<p>Peptide H-GQVFDVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITDQVPFSV^-OH
<p>Peptide H-ITDQVPFSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DHIGTR^-OH
<p>Peptide H-DHIGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDATEESDLAQQYGVR^-OH
<p>Peptide H-VDATEESDLAQQYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 104
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,697.1 g/molAc-LRLRGG-CHO
<p>Peptide Ac-LRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIFAGKQLEDGR-NH2
<p>Peptide H-LIFAGKQLEDGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-MACPGFLWALVISTCLEFSMA-NH2
Peptide LCBiot-MACPGFLWALVISTCLEFSMA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVESLPQEIK^-OH
<p>Peptide H-LVESLPQEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNDDDTFTVK^-OH
Peptide H-YNDDDTFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISTLNSHNLPILR^-OH
Peptide H-ISTLNSHNLPILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CVKKDQLGKN-OH
<p>Peptide Ac-CVKKDQLGKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Trp63,Trp64)-C3a (63-77)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C86H134N26O18Molecular weight:1,820.17 g/molH-IFFYDSENPPASEVLR^-OH
Peptide H-IFFYDSENPPASEVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 35
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,621.9 g/molH-GFFYTPK^-OH
<p>Peptide H-GFFYTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-E^V^D^P^I^G^HL^Y^-OH
<p>Peptide H-E^V^D^P^I^G^HL^Y^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CUB Domain Containing Protein 1 (CDCP1) (C-Term), (Isoform 1)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Lauric Acid-HNKHLPSTQPLA-OH
Peptide Lauric Acid-HNKHLPSTQPLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pancreastatin (Dephosphorylated Porcine)
CAS:Pancreatastatin is a peptide hormone that inhibits energy metabolism. Pancreatastatin is a biologically active peptide that has been isolated from the pancreas and shown to have effects on the endocrine system, including regulation of feeding behavior. Pancreatastatin is also known as somatostatin and is found in both animals and humans. Pancreatastatin has been shown to inhibit cellular proliferation and decrease tumor size in animal models of cancer, as well as to regulate blood sugar levels in diabetic patients. Pancreatastatin is also used for treating bowel diseases such as colitis.Formula:C214H330N68O76SPurity:Min. 95%Molecular weight:5,103.49 g/molAc-CIHEEKPQDTISQ-NH2
<p>Peptide Ac-CIHEEKPQDTISQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGMQIFV^K-OH
<p>Peptide H-GGMQIFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fibromodulin F1 7-17 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolTentaGel® R RAM Resin (90 um), Rink-type
<p>TentaGel® R RAM Resin (90 um), Rink-type can be used for the preparation of peptide amides (Rink-type) (90 µm) 018-022 meq/g and is specially designed for difficult and long sequences.<br>TentaGel, is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix.</p>Purity:Min. 95%Z-GFFL-OH
<p>Peptide Z-GFFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Chorionic Gonadotropin Human
<p>Human chorionic gonadotropin (hCG) is a peptide hormone produced in pregnancy, that is made by the embryo soon after conception and later by the part of the placenta. Its role is to prevent the disintegration of the corpus luteum of the ovary and thereby maintain progesterone production that is critical for a pregnancy in humans. hCG may have additional functions, for instance it is thought that it affects the immune tolerance of the pregnancy. Early pregnancy testing generally is based on the detection or measurement of hCG.</p>Purity:Min. 95%SIVmac239-1
<p>Peptide SIVmac239-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C65H115N21O23S1Molecular weight:1,590.83 g/molH-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELLAHK^-OH
Peptide H-YVYIAELLAHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVAVYADQAK^-OH
<p>Peptide H-AVAVYADQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVIDDAFAR^-OH
Peptide H-AVIDDAFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pyr-Arg-Thr-Lys-Arg-MCA
CAS:<p>MCA conjugated molecule targeting furin</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molHIV-1 gag Protein p24 (65-73) (isolates MAL/U455)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C44H79N11O14S2Molecular weight:1,050.31 g/molAc-Arg-Gly-Lys-MCA
CAS:<p>Ac-Arg-Gly-Lys-MCA is a histone deacetylase inhibitor that belongs to the class of peptides. This drug has been shown to inhibit the activity of histone deacetylases and can be used for the treatment of diabetes. Ac-Arg-Gly-Lys-MCA is an enzyme substrate, which means it is not active when taken orally. It must be administered intravenously or intraperitoneally in order to be metabolized by enzymes in the body.</p>Formula:C26H38N8O6Purity:Min. 95%Molecular weight:558.63 g/molH-P^GLYYF-OH
<p>Peptide H-P^GLYYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLATVYVDVLK^-OH
<p>Peptide H-DLATVYVDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-IDMVD-OH
Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQY^NSTYR-OH
Peptide H-EEQY^NSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Azido-RKKRRQRRR-NH2
<p>Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RK9, p17 Gag (20 - 28)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C45H86N18O10Molecular weight:1,039.3 g/molFibronectin Adhesion-Promoting Peptide
CAS:<p>Fibronectin Adhesion-Promoting Peptide is a polyclonal antibody that recognizes fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin promotes cell adhesion and proliferation by binding to collagen. This antibody can be used to detect fibronectin in tissues from patients with cancer. It may also be used as a tool for identifying cancer cells that have metastasized to other sites in the body.</p>Formula:C47H74N16O10Purity:Min. 95%Molecular weight:1,023.22 g/molEptifibatide
CAS:<p>Eptifibatide is a drug that is used in the treatment of congestive heart failure, acute coronary syndrome and peripheral artery disease. It is a glycoprotein IIb/IIIa inhibitor that binds to integrin receptors on platelets and prevents them from binding to fibrinogen. This prevents blood clotting and reduces the risk of stroke or heart attack. Eptifibatide has been shown to be effective for the treatment of bowel disease, infectious diseases, and experimental models of myocardial infarcts. The drug has significant cytotoxicity, which may be due to its ability to inhibit cell proliferation by blocking protein synthesis at the ribosome level.<br>Eptifibatide has been shown to have a disulfide bond between two cysteine residues located in its amino-terminal region. This bond stabilizes the molecule in solution and ensures that it remains active until it reaches its target site.</p>Formula:C35H49N11O9S2Purity:Min. 95%Molecular weight:831.98 g/mol5Fam-VIFDANAPVAVR-OH
<p>Peptide 5Fam-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![Hemoglobin β chain [133-146]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50835.webp&w=3840&q=75)
![[pGlu3]-Amyloid-β Protein (3-42) (Human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50602.webp&w=3840&q=75)
![H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3761-PI.webp&w=3840&q=75)
![[Dap3]-Ghrelin (Human, Rat, 1-5)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPGH-3681-PI.webp&w=3840&q=75)
