
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30318 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
6Fam-SHLVEALYLVCGERG-NH2
<p>Peptide 6Fam-SHLVEALYLVCGERG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTL^MI^SR-OH
<p>Peptide H-DTL^MI^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSEIQLMHNLGK^^-OH
<p>Peptide H-SVSEIQLMHNLGK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CKALKSGKIEGEDRK-NH2
<p>Peptide H-CKALKSGKIEGEDRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVEEVSLRK^-OH
Peptide H-AVEEVSLRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-NAPVSIPQ-OH
Peptide Fluor-NAPVSIPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLWC-NH2
<p>Peptide H-HLWC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-REDEDEIEW-NH2
<p>Peptide H-REDEDEIEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVVTQF^-OH
Peptide H-TVVTQF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dabcyl-SFNFPQIT-Edans
Peptide Dabcyl-SFNFPQIT-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEGDGV^YTLNDK^-OH
<p>Peptide H-TEGDGV^YTLNDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^TSAVLQ-OH
Peptide H-K^TSAVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALQASALAAWGGK^-OH
<p>Peptide H-ALQASALAAWGGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HMTEVVR^HC-OH
<p>Peptide H-HMTEVVR^HC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^TSAVLQSGFRKME-OH
<p>Peptide H-K^TSAVLQSGFRKME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2
Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 17
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,619.8 g/molH-YGLVTYATYPK^-OH
Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 19 (NQLQVQHTYFTGSEV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,750.9 g/molH-GCSFLPDPYQK^-OH
<p>Peptide H-GCSFLPDPYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNVDEVGGEALGR^^-OH
<p>Peptide H-VNVDEVGGEALGR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTLYITR^-OH
<p>Peptide H-DTLYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLLEYLEEK^-OH
<p>Peptide H-LLLEYLEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Tamra-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5Tamra-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITGLDPAGPNFEYAEAPSR^-OH
<p>Peptide H-ITGLDPAGPNFEYAEAPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CYIQNCPLG-NH2
<p>Peptide Ac-CYIQNCPLG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tum-P35B Peptide (NGPPHSNNFGY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-VPTANVSVVDLTCR^-OH
Peptide H-VPTANVSVVDLTCR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C43H69N9O11SMolecular weight:920.12 g/molH-STGSWSTLK^-OH
<p>Peptide H-STGSWSTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Nuclear-encoded Humanin [HN(N)] (Rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:4,311.08 g/molH-NEALIALLR^-OH
<p>Peptide H-NEALIALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPFPGP^IP^NS-OH
<p>Peptide H-YPFPGP^IP^NS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-I^LGGQE-OH
<p>Peptide H-I^LGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGGGVSMANAANIPSK^-OH
<p>Peptide H-LGGGVSMANAANIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Rpr-NH2
<p>Peptide Ac-Rpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biotin-LC-BimS BH3 (51-76) acid
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-MGKLSKIWDLPL^DE-OH
<p>Peptide H-MGKLSKIWDLPL^DE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-LMKNMDPLNDNV-NH2
<p>Peptide Fluor-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-57
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,571.7 g/molAc-YHPSAGDRFNRQRPC-NH2
<p>Peptide Ac-YHPSAGDRFNRQRPC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LRGGAPTK-NH2
Peptide Ac-LRGGAPTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-43/aa169 - 183
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,563.8 g/molH-NTAYLQMNSL^R-OH
Peptide H-NTAYLQMNSL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKIQEFHVDGKE-NH2
<p>Peptide Ac-CKIQEFHVDGKE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB is a high purity resin that is used as an ion channel blocker in research. It has been used to study the interactions between ligands and receptors, and is also used as a pharmacology research tool. This product has a CAS number of 61741-00-8.Purity:Min. 95%H-DSGSSLIR^-OH
<p>Peptide H-DSGSSLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LNFARKRIKNPEGGLC-NH2
Peptide Ac-LNFARKRIKNPEGGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-YGGFLRRQFKVVT-OH
Peptide Ac-YGGFLRRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPDVSSAL^DK-OH
<p>Peptide H-TPDVSSAL^DK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 62 (TLGSDVEEDLTMTRN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,680.8 g/molAc-Ala-Ala-Ala-NH2
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C11H20O4N4Molecular weight:272.3 g/molH-EDLTEIR^-OH
<p>Peptide H-EDLTEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIEHIMEDLDTNADK^-OH
<p>Peptide H-VIEHIMEDLDTNADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 101 (TSGSDSDEELVTTER)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,625.6 g/molPPI 2-10 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolHPV 16 E2 69-77 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-AQAVHPGYGFLSENK^-OH
<p>Peptide H-AQAVHPGYGFLSENK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LVLRLRGG-OH
<p>Peptide Ac-LVLRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DQGGELLSLR^-OH
<p>Peptide H-DQGGELLSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNSGK^-OH
<p>Peptide H-YNSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FMDVYQR^-OH
<p>Peptide H-FMDVYQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Azidohexyl-RLVSYNGIIFFLK-NH2
Peptide Azidohexyl-RLVSYNGIIFFLK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:1,708.11 g/molH-YEIVVEAR^-OH
Peptide H-YEIVVEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CYKSHLMSTVRSPTASESRN-OH
<p>Peptide Ac-CYKSHLMSTVRSPTASESRN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALPASIEK^-OH
<p>Peptide H-ALPASIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARTKQTARKSTGGKAPRKQLA^-OH
Peptide H-ARTKQTARKSTGGKAPRKQLA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KGSTAENAEYLRV-NH2
<p>Peptide Ac-KGSTAENAEYLRV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Integrin Ligand peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C23H42N10O10·C2HF3O2Molecular weight:732.66 g/molH-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH
<p>Peptide H-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Val-Ile-Gly
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C13H25N3O4Molecular weight:287.36 g/molH-SGGVVK^-OH
Peptide H-SGGVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIDEVSSLLR^-OH
Peptide H-DIDEVSSLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GLARS-NH2
<p>Peptide Ac-GLARS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-INPASLDK-OH
<p>Peptide LCBiot-INPASLDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGDGTVIL^^K^^-OH
<p>Peptide H-VGDGTVIL^^K^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTQSGSLLFIGR^-OH
<p>Peptide H-DTQSGSLLFIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CMASHLRRSQY-OH
<p>Peptide Ac-CMASHLRRSQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDGVAGLYR^-OH
<p>Peptide H-SDGVAGLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYSNFLR^-OH
<p>Peptide H-VYSNFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH
Peptide LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGYETFR^-OH
<p>Peptide H-SGYETFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALVTDADNVIPK^-OH
<p>Peptide H-ALVTDADNVIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LMP2 (236 - 244) , RRR
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C56H99N25O11Molecular weight:1,298.5 g/molAc-RKRR-NH2
<p>Peptide Ac-RKRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSEDFLQDVSASTK^-OH
<p>Peptide H-VVSEDFLQDVSASTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GYSFVTTAER^-OH
<p>Peptide H-GYSFVTTAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lunasine
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C204H321N65O78S3Molecular weight:5,028.32 g/molH-SGFRK^ME-OH
<p>Peptide H-SGFRK^ME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSDYFKPFSTGK^-OH
<p>Peptide H-YSDYFKPFSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIFDANAPVAVR^-OH
Peptide H-VIFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Suc-KRRK-NH2
<p>Peptide Suc-KRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHITSLLPTPEDNLEIVLHR^-OH
<p>Peptide H-VHITSLLPTPEDNLEIVLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGASVLGL^-OH
<p>Peptide H-LLGASVLGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALGISPFHEHAEVVFTANDSGPR^-OH
<p>Peptide H-ALGISPFHEHAEVVFTANDSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-LFGGY-OH
<p>Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELRRKMMYM-NH2
<p>Peptide H-ELRRKMMYM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aoa-THRPPMWSPVWP-NH2
<p>Peptide Aoa-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGEVQEPELR^-OH
<p>Peptide H-AGEVQEPELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATEIIEPSK^-OH
Peptide H-ATEIIEPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLSALQAVQGLLVAQGR^-OH
<p>Peptide H-VLSALQAVQGLLVAQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNFGDDIPSALR^-OH
<p>Peptide H-LNFGDDIPSALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHLTTGGDVR^-OH
<p>Peptide H-SHLTTGGDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVAVSQVAR^-OH
<p>Peptide H-SVAVSQVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-29
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,554.6 g/molH-DSTYSLSSTLTLSK^-OH
<p>Peptide H-DSTYSLSSTLTLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 12
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,618.8 g/molH-IQIIPK^-OH
<p>Peptide H-IQIIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,093.3 g/molH-ATNYNAGDR^-OH
<p>Peptide H-ATNYNAGDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLEGSDDAVLLQR^-OH
Peptide H-SLEGSDDAVLLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-FRHD-OH
<p>Peptide pE-FRHD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 31 (LNIPSINVHHYPSAA)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,632.8 g/molH-NAVPITPTLNR^-OH
<p>Peptide H-NAVPITPTLNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α-Neo-Endorphin, porcine
Peptide α-Neo-Endorphin, porcine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C60H89N15O13Molecular weight:1,228.47 g/molLCBiot-VTSAPDTRPAPGSTAPPAHG-OH
<p>Peptide LCBiot-VTSAPDTRPAPGSTAPPAHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EL^SEALGQIFDSQR^-OH
<p>Peptide H-EL^SEALGQIFDSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVGAGGVGK^-OH
Peptide H-VVVGAGGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPALHFLGGGSC-NH2
Peptide H-SPALHFLGGGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,771 g/molAc-KIFMK-NH2
<p>Peptide Ac-KIFMK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVQVHQDTLR^-OH
<p>Peptide H-AVQVHQDTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NIYLNSGLTSTK^-OH
<p>Peptide H-NIYLNSGLTSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HCMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-LTYYTPEYETK^-OH
<p>Peptide H-LTYYTPEYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Gly-Arg-Gly-Asp-Asn-Pro-OH
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C23H38N10O10Molecular weight:614.6 g/molH-ELINNELSHFLEEIK^-OH
<p>Peptide H-ELINNELSHFLEEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHP-NH2
Peptide H-DRVYIHP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRPKPQQFFGLM-NH2
<p>Peptide H-CRPKPQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH
<p>Peptide H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:3,247.64 g/molH-QYFFET^K-OH
<p>Peptide H-QYFFET^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGAVYSSDEAL^IPIR-OH
<p>Peptide H-FGAVYSSDEAL^IPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYAEVNSLR^-OH
<p>Peptide H-VYAEVNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFLRRIRPK^LK^-OH
<p>Peptide H-YGGFLRRIRPK^LK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFGYPVYV^-OH
<p>Peptide H-LLFGYPVYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGKKQNRKTGNSKTC-NH2
<p>Peptide H-MGKKQNRKTGNSKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Val-Ile-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C20H31N3O4Molecular weight:377.48 g/molH-QGVAEAAGK^-OH
Peptide H-QGVAEAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENAGEDPGLAR^-OH
<p>Peptide H-ENAGEDPGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CAQAGLKPEQA-NH2
<p>Peptide Ac-CAQAGLKPEQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SRT-NH2
<p>Peptide Ac-SRT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HER2/neu(654-662) GP2
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C42H77N9O11Molecular weight:884.12 g/molCbz-LLE-AMC
<p>Peptide Cbz-LLE-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNVQGDTK^-OH
<p>Peptide H-LNVQGDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGLPLEEVTVAEVLAAR^-OH
Peptide H-GGLPLEEVTVAEVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QVLQVTPFAER-OH
<p>Peptide H-QVLQVTPFAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C58H94N16O17Molecular weight:1,287.49 g/molH-TDTGVSLQTYDDLLAK^-OH
<p>Peptide H-TDTGVSLQTYDDLLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSLVPDSEQGEAILPR^-OH
<p>Peptide H-LSLVPDSEQGEAILPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGFVFTL^T-OH
Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-G^P-OH
<p>Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PB1(703 - 711), Influenza
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C45H75N15O13Molecular weight:1,034.19 g/molH-EFSEV^EGR-OH
<p>Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLVYTILPDGEVVGDSAK^-OH
<p>Peptide H-LLVYTILPDGEVVGDSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 119
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,909.2 g/molH-HSVVVPYEPPEAGSEYTTIHYK^-OH
<p>Peptide H-HSVVVPYEPPEAGSEYTTIHYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DRVYIHPF-OH
<p>Angiotensin II plays an essential role in the maintenance of blood pressure and blood volume. It is a peptide hormone that causes vasoconstriction, a sensation of thirst, and stimulation of the adrenal cortex and aldosterone.<br>Derived from the cleavage of angiotensin I by the angiotensin converting enzyme, angiotensin II is involved in the renin-angiotensin system (RAS).<br>Angiotensin II is the subject of much scientific research and is already the target of many anti-hypertensive drugs (ACE inhibitors, ARBs or AT1 receptor antagonists).</p>H-LDIDSAPITAR^-OH
<p>Peptide H-LDIDSAPITAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNPTVEVDLFTSK^-OH
<p>Peptide H-GNPTVEVDLFTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>VIP Antagonist
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C154H257N49O40SMolecular weight:3,467.13 g/molH-AQAASLEAEHQAIIR^-OH
<p>Peptide H-AQAASLEAEHQAIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CONSENSUS B Tat - 05
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,694.1 g/molHXB2 gag NO-9/aa33 - 47
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,827.1 g/molH-GPTGTGESKC-NH2
<p>Peptide H-GPTGTGESKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSSVSGIFTFQK^-OH
<p>Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAFQEALDAAGDK^-OH
<p>Peptide H-TAFQEALDAAGDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IKGEHPGLSIGDVAK^-OH
<p>Peptide H-IKGEHPGLSIGDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDDYYYGFGCNKFGRPRDD-NH2
<p>Peptide H-CDDYYYGFGCNKFGRPRDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAAQK^-OH
<p>Peptide H-DAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVLTIDK^K^-OH
Peptide H-AVLTIDK^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 73
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,861.1 g/molAc-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.V14 Peptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,356.5 g/molH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
<p>Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Human Histatin 2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C158H211N45O44Molecular weight:3,444.6 g/molH-VMAPRTLL^-OH
<p>Peptide H-VMAPRTLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Midkine (Human)
CAS:<p>Lys-Lys-Lys-Asp-Lys-Val-Lys-Lys-Gly-Gly-Pro-Gly-Ser-Glu-Cys-Ala-Glu-Trp-Ala-Trp-Gly-Pro-Cys-Thr-Pro-Ser-Ser-Lys-Asp-Cys-Gly-Val-Gly-Phe-Arg-Glu-Gly-Thr-Cys-Gly-Ala-Gln-Thr-Gln-Arg-Ile-Arg-Cys-Arg-Val-Pro-Cys-Asn-Trp-Lys-Lys-Glu-Phe-Gly-Ala-Asp-Cys-Lys-Tyr-Lys-Phe-Glu-Asn-Trp-Gly-Ala-Cys-Asp-Gly-Gly-Thr-Gly-Thr-Lys-Val-Arg-Gln-Gly-Thr-Leu-Lys-Lys-Ala-Arg-Tyr-Asn-Ala-Gln-Cys-Gln-Glu-Thr-Ile-Arg-Val-Thr-Lys-Pro-Cys-Thr-Pro-Lys-Thr-Lys-Ala-Lys-Ala-Lys-Ala-Lys-Lys-Gly-Lys-Gly-Lys-Asp (Disulfide bonds between Cys15-Cys39, Cys23-Cys48, Cys30-Cys52, Cys62-Cys94, and Cys72-Cys104)</p>Formula:C570H915N177O167S10Purity:Min. 95%Molecular weight:13,240.1 g/molH-V^V^GGL^V^ALR^-OH
<p>Peptide H-V^V^GGL^V^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CDDLIKVVEELTRIH-OH
Peptide Ac-CDDLIKVVEELTRIH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQIDPV^K-OH
<p>Peptide H-IQIDPV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FASFEAQGALANIAVDK^-OH
<p>Peptide H-FASFEAQGALANIAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DKFNHEAEDLFYQ-NH2
Peptide Ac-DKFNHEAEDLFYQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTKYTSSK-NH2
Peptide H-AVTKYTSSK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGFTGGDILR^-OH
Peptide H-GPGFTGGDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FHTITTSYYR^-OH
<p>Peptide H-FHTITTSYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APGLTQALNTK^-OH
<p>Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SLGRKIQI-NH2
<p>Peptide Ac-SLGRKIQI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AKFVAAWTLKAA-NH2
<p>Peptide Ac-AKFVAAWTLKAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Suc-KGFLGK-NH2
<p>Peptide Suc-KGFLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQSLQDEVAFLR^-OH
<p>Peptide H-VQSLQDEVAFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tesamorelin acetate
CAS:<p>Tesamorelin acetate is a synthetic peptide that functions as a growth hormone-releasing hormone (GHRH) analog. It is derived through complex chemical synthesis techniques that mimic the natural GHRH sequences found in the human body. The mode of action of Tesamorelin involves binding to GHRH receptors in the pituitary gland, which stimulates the secretion of growth hormone. This increase in growth hormone levels subsequently enhances insulin-like growth factor-1 (IGF-1) production, leading to various metabolic effects.Tesamorelin acetate is primarily utilized in the medical field for the reduction of excess visceral adipose tissue in patients with HIV-associated lipodystrophy. This condition leads to the abnormal distribution of body fat, posing significant health risks. By modulating the growth hormone axis, Tesamorelin helps in decreasing visceral fat accumulation, thereby improving body composition and metabolic health in affected individuals. It is important to note that the use of Tesamorelin should be carefully monitored within clinical settings to assess efficacy and safety.</p>Formula:C221H366N72O67SPurity:Min. 98 Area-%Color and Shape:PowderH-TTPPV^LDSDGSFFLYSR^-OH
<p>Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-I^L^AR-OH
<p>Peptide H-I^L^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSDLIVLGLPWK^-OH
Peptide H-TSDLIVLGLPWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFAQLSELHCDK^-OH
<p>Peptide H-GTFAQLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALVLIAFAQYLQQCPFEDHVK^-OH
Peptide H-ALVLIAFAQYLQQCPFEDHVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CMQNPYSRHSSMPRPDY-OH
<p>Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ELSWSADSIRLQISNPD-NH2
<p>Peptide Ac-ELSWSADSIRLQISNPD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KITDFGRAK^-OH
<p>Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
