Peptides
Subcategories of "Peptides"
Found 29793 products of "Peptides"
H-VALAGEYGAVTYR^-OH
Peptide H-VALAGEYGAVTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fibronectin Active Fragment (RGDS)
CAS:Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity. The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling. The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.Formula:C15H27N7O8Purity:Min. 95%Molecular weight:433.42 g/molSubstance P
Peptide Substance P is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C63H98N18O13SMolecular weight:1,347.66 g/molAc-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt
CAS:Ac-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt is a peptide that has been shown to have anti-cancer, enzyme inhibitory, and anti-inflammatory activities. The peptide is derived from the proteolytic cleavage of human collagenase. It inhibits both matrix metalloproteinases (MMPs) and stromelysin in vitro. Acetyl Proleu Gly Gly Leu Gly OEt has also been shown to inhibit cancer cells in culture by inhibiting RNA synthesis and protein synthesis.Formula:C31H53N5O8SPurity:Min. 95%Molecular weight:655.86 g/molH-VVSVLTVLHQDWLNGK-OH
Peptide H-VVSVLTVLHQDWLNGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C83H132N22O22Molecular weight:1,808.1 g/molAc-NRRRRWRERQR-NH2
Peptide Ac-NRRRRWRERQR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPDFTNENPLETR^-OH
Peptide H-SPDFTNENPLETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-Furoyl-LIGRLO-amide acetate salt
CAS:2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn-NH2 is a synthetic peptide that binds to the 5HT3 receptor. It has been shown to have an effect on locomotor activity and growth factor secretion in wild type mice and cell culture, as well as binding to acetylcholine receptors in C57/BL6 mice. 2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn was synthesized by the reaction of furoic acid with L -alanine, L -glycine, L -arginine and L -ornithine. The product is a white powder.Formula:C36H63N11O8Purity:Min. 95%Molecular weight:777.96 g/molH-SNTSESF-NH2
Peptide H-SNTSESF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SSVFAQ-OH
Peptide Ac-SSVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSPDDSAGASALLR^-OH
Peptide H-FSPDDSAGASALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VLRLRGG-CHO
Peptide Ac-VLRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VATEFSETAPATLK^-OH
Peptide H-VATEFSETAPATLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin Basic Protein (111-129)
The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur and theses occurrences can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways. Although more research needs to be carried out, it is thought that MBP significantly contribute to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models. One-Letter Formula: LSRFSWGAEGQRPGFGYGGFormula:C92H129N27O26Purity:Min. 95%Molecular weight:2,029.22 g/molBMP 4 Human
BMP 4 Human is a recombinant human protein that is a member of the TGF-β superfamily. It interacts with Ligand, Receptor, and Activator and has been shown to inhibit Ion channels in vitro. BMP 4 Human is a research tool for studying signaling pathways in pharmacology and cell biology.Purity:>95% By Sds-Page And Rp-HplcFmoc-Tyr(tBu)-Wang Resin (100-200 mesh) 1% DVB
Please enquire for more information about Fmoc-Tyr(tBu)-Wang Resin (100-200 mesh) 1% DVB including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%H-KFRKAFKR^FF-OH
Peptide H-KFRKAFKR^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDGPVQGIINFEQK^-OH
Peptide H-GDGPVQGIINFEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TBTU Reagent
CAS:TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).Formula:C11H16N5OBF4Purity:Min. 95%Molecular weight:321.08 g/molTertiapin Q
CAS:Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.
Formula:C106H175N35O24S4Purity:Min. 95%Molecular weight:2,452.05 g/molFmoc-D-His(Trt)-OH
CAS:Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum. Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and reFormula:C40H33N3O4Purity:Min. 95%Molecular weight:619.73 g/molFmoc-11-aminoundecanoic acid
CAS:Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.
Formula:C26H33NO4Purity:Min. 98.0 Area-%Molecular weight:423.56 g/molH-RHFWQQDEPPQSPWDR^-OH
Peptide H-RHFWQQDEPPQSPWDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RQDNEILIFWSK^-OH
Peptide H-RQDNEILIFWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFormula:C192H295N61O60SPurity:Min. 95%Molecular weight:4,449.93 g/molH-VLLQTLR^-OH
Peptide H-VLLQTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-TVQDALSSVQESDIAVVAR^-OH
Peptide H-TVQDALSSVQESDIAVVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ADDGRPFPQVIK^-OH
Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RHSVV-NH2
Peptide H-RHSVV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
hTRT 674-683 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-ELAVAAAYQSVR^-OH
Peptide H-ELAVAAAYQSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-NISH-pNA
Peptide Ac-NISH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 102 (DSDEELVTTERKTPR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,775.9 g/molH-TDSRCVIGLYHPPLQVY-NH2
Peptide H-TDSRCVIGLYHPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
α-CGRP (mouse, rat)
CAS:Endogenous calcitonin gene-related peptide receptor (CGRP) agonist which is secreted in both peripheral and central neurons. It is a potent vasodilator and can function in the transmission of nociception as well as acting as an appetite suppressant and contributing to gastric acid secretion. It also has a function in temperature homeostasis, increases heart rate, and can play a role in the release of the pituitary hormone.Formula:C162H262N50O52S2Purity:Min. 95%Color and Shape:PowderMolecular weight:3,806.25 g/molH-IGSTENLK^-OH
Peptide H-IGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVDEATIIDILTK^-OH
Peptide H-GVDEATIIDILTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HCTU Reagent
CAS:HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.Formula:C11H15N5OClPF6Purity:Min. 98.0 Area-%Molecular weight:413.69 g/molAc-RIIYDRKFLMECRN-NH2
Peptide Ac-RIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH
CAS:H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/molH-SNGPVKV^-OH
Peptide H-SNGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DENPVVHFFKNIVTPRTPP-NH2
Peptide H-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys)
CAS:Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.
Formula:C34H52N10O12Purity:Min. 95%Molecular weight:792.85 g/molPAR-2 (1-6) amide (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C29H56N10O7Molecular weight:656.83 g/molH-SVVTVIDVFYK^-OH
Peptide H-SVVTVIDVFYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C96H174N36O29Molecular weight:2,296.7 g/molLCMV gp 276-286 (H-2 Db)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C46H70N12O17SMolecular weight:1,095.18 g/molH-NPQLCYQDTILWK^-OH
Peptide H-NPQLCYQDTILWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50524.webp&w=3840&q=75)
