
Peptides
Subcategories of "Peptides"
Found 29708 products of "Peptides"
SIVmac239 - 71
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,714 g/molH-IIVPLNNR^-OH
Peptide H-IIVPLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PLP (178-191)
CAS:PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Formula:C70H106N18O22SMolecular weight:1,583.8 g/molH-MAIPPKKNQDKTEIPTINT-OH
Peptide H-MAIPPKKNQDKTEIPTINT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELTR-NH2
Peptide H-ELTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,788.1 g/molAc-VLRLRGG-CHO
Peptide Ac-VLRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGASVLGL^-OH
Peptide H-LLGASVLGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fibromodulin F1 7-17 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-LITVQVVPVAAR^-OH
Peptide H-LITVQVVPVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-DAEFRHDSGYEVHHQ-OH
Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^FF-OH
Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALPAPIEK^TISK-NH2
Peptide H-ALPAPIEK^TISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LVLRLR-OH
Peptide Ac-LVLRLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLDPER^-OH
Peptide H-TLDPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-LFGGY-OH
Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLQSALAAIR^ -OH
Peptide H-VLQSALAAIR^ -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KVLEHVVR^V-OH
Peptide H-KVLEHVVR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-RLYRKRIWRSAGR-OH
Peptide Myr-RLYRKRIWRSAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALGISPFHEHAEVVFTANDSGPR^-OH
Peptide H-ALGISPFHEHAEVVFTANDSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QQF^FGLM-NH2
Peptide H-QQF^FGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALDAAYCFR^-OH
Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 53
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,703.8 g/molH-TEEISEVK^-OH
Peptide H-TEEISEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,845.2 g/molSIVmac239 - 82
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,569.9 g/molH-NWGLSVYADKPETTK^-OH
Peptide H-NWGLSVYADKPETTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELAFNLPSR^-OH
Peptide H-ELAFNLPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVLTIDKK^-OH
Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH
Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELFSYLIEK^-OH
Peptide H-ELFSYLIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-EDPDYEWPSA-NH2
Peptide Biot-EDPDYEWPSA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQTAAQR^-OH
Peptide H-FQTAAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KVPRNQDWL-OH
Peptide Ac-KVPRNQDWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-NISH-pNA
Peptide Ac-NISH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NAP
Peptide NAP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C36H60N10O12Molecular weight:824.94 g/molAc-PCH-NH2
Peptide Ac-PCH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TDSRCVIGLYHPPLQVY-NH2
Peptide H-TDSRCVIGLYHPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALP^AP^IEK^-OH
Peptide H-ALP^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aoa-THRPPMWSPVWP-NH2
Peptide Aoa-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 27
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,699 g/molH-GADGVGK^SA-OH
Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYDLDPGAGSLEI^-OH
Peptide H-SYDLDPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5-FAM-LRRASLG-OH
Peptide 5-FAM-LRRASLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGSDALDDFDLDML-NH2
Peptide H-CGSDALDDFDLDML-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Peptide Ac-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-ASRMEEVD-OH
Peptide Biot-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 45
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,697.9 g/mol
