
Peptides
Subcategories of "Peptides"
Found 29706 products of "Peptides"
SIVmac239 - 69
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,794.2 g/molLCBiot-SMFVYGGCQGNNNNFQSKANC-NH2
Peptide LCBiot-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSISIQTEEQIHGK^-OH
Peptide H-GSISIQTEEQIHGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fibromodulin F3 250-259 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-ARTKQTARKSTGGKA-NH2
Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV Seq2 aa: 179-186
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C52H70N10O10Molecular weight:995.17 g/molAc-WDCCPGCCK-NH2
Peptide Ac-WDCCPGCCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MeO-Suc-Arg-Pro-Tyr-pNA
Peptide MeO-Suc-Arg-Pro-Tyr-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Molecular weight:668.71 g/molMyr-FTEIPTI-OH
Peptide Myr-FTEIPTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITGR^LQSL-OH
Peptide H-LITGR^LQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVGGQEHFAHLLILR^-OH
Peptide H-YVGGQEHFAHLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 93 (FTSQYRIQGKLEYRH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,927.2 g/molAc-TYFAVLM-NH2
Peptide Ac-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLAEVATGEK^-OH
Peptide H-YLAEVATGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SYTITGLQPGTDYK^-OH
Peptide H-SYTITGLQPGTDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGGGG-Dabcyl
Peptide H-GGGGG-Dabcyl is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Bax H2 - H3 (53 - 86), Helix 2 - 3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:3,797.3 g/molH-R^EQAPNLVY-OH
Peptide H-R^EQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Tertiapin-Q trifluoroacetate salt
CAS:A peptide found in honey bee venom; Potassium channel inhibitorFormula:C106H175N35O24S4Purity:Min. 95%Molecular weight:2,452.01 g/molH-LNIPTDVLK^-OH
Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
N-Me-D-Glu-OH
CAS:N-Me-D-Glu is an amino acid that is a substrate for the enzyme glutamate dehydrogenase. It is also a substrate for the enzyme N-acetylglutamate synthase and can be converted to glutamine. This amino acid has been extensively studied in relation to its conformational properties and its ability to form covalent adducts with amines. The type species of this amino acid is Saccharomyces cerevisiae, which contains an active glutamate dehydrogenase.Formula:C6H11NO4Purity:Min. 95%Molecular weight:161.16 g/molH-DI^TPTLTLYVGK^-OH
Peptide H-DI^TPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Substance P -Gly-Lys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C71H112N20O16SMolecular weight:1,533.8 g/molCMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,800.1 g/molH-TGLQLSQDPTGR^-OH
Peptide H-TGLQLSQDPTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGMNIVEAMER^-OH
Peptide H-EGMNIVEAMER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGKPAPDFK^-OH
Peptide H-IGKPAPDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KALYDYAPI-OH
Peptide H-KALYDYAPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C51H74N10O13Color and Shape:PowderMolecular weight:1,053.21 g/molGP120 - W61D - 11
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,652.9 g/mol5Fam-F-OH
Peptide 5Fam-F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LNRCVAKYHGYPWCRRR-NH2
Peptide Ac-LNRCVAKYHGYPWCRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIINFEKL^-OH
CAS:Peptide H-SIINFEKL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:970 g/molAc-Rpw-NH2
Peptide Ac-Rpw-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
G-R-G-D-S-P
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C22H37N9O10Molecular weight:587.59 g/molH-EPISVSSEQVLK^-OH
Peptide H-EPISVSSEQVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPLTATLSK^-OH
Peptide H-TPLTATLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-EEEEE-OH
Peptide Ac-EEEEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTPQAFSHFTFER^-OH
Peptide H-LTPQAFSHFTFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GIYQTSNFR^-OH
Peptide H-GIYQTSNFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NPANPV^QR-OH
Peptide H-NPANPV^QR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESHVTLASPEETR^-OH
Peptide H-ESHVTLASPEETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-DRVYIHP-OH
Peptide 5Fam-DRVYIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGVYELLLK^-OH
Peptide H-LGVYELLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peptide T
Peptide Peptide T is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C35H55N9O16Molecular weight:857.8 g/molH-EGYYGYTG^AFR^-OH
Peptide H-EGYYGYTG^AFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys27(Azido), Exendin-4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C189H293N52O61SMolecular weight:4,311.96 g/mol
