
Peptides
Subcategories of "Peptides"
Found 29634 products of "Peptides"
CMVpp65 - 52 (VCSMENTRATKMQVI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,711.1 g/molGAD65 (206-220)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C86H129N15O24Molecular weight:1,757.07 g/molSIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,695 g/molH-YPLIQTLR^-OH
Peptide H-YPLIQTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-VLPQDKEYYKVKEPGE-NH2
Peptide LCBiot-VLPQDKEYYKVKEPGE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C13H24N4O6S1Molecular weight:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPMSPR^-OH
Peptide H-DLPMSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFEILSPVYR^-OH
Peptide H-FFEILSPVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIYETDYYR^-OH
Peptide H-DIYETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-2Kb Mouse L protein LEYDFNKL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-MDYKDHDGDYKDHDIDYKDDDDK-NH2
Peptide H-MDYKDHDGDYKDHDIDYKDDDDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mage-1 Antigen (161-169), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C41H57N11O17Molecular weight:975.97 g/molMYH9 741-749 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-SFGWDLAK^-OH
Peptide H-SFGWDLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SGVGNDLVL-NH2
Peptide Ac-SGVGNDLVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LSALTPSPSWLKYKAL-NH2
Peptide LCBiot-LSALTPSPSWLKYKAL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PLLA-OH
Peptide Ac-PLLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-EEMQRR^-NH2
Peptide Ac-EEMQRR^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRVYIHPF-NH2
Peptide H-DRVYIHPF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CKSGTGIAAMSVMRPEQ-NH2
Peptide Ac-CKSGTGIAAMSVMRPEQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGNEIQYVALR^-OH
Peptide H-VGNEIQYVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-FSPDDSAGASALLR-OH
Peptide LCBiot-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IADFGLAR^-OH
Peptide H-IADFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLADELALVDVIEDK^-OH
Peptide H-DLADELALVDVIEDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYPWTQR-NTPEGBiot
Peptide H-VYPWTQR-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-REEE-NH2
Peptide H-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVGDVVAYIQK^-OH
Peptide H-TVGDVVAYIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTGGANIDPTFFLSR^-OH
Peptide H-GTGGANIDPTFFLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQLANDVVL^-OH
Peptide H-AQLANDVVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGCVGK^-OH
Peptide H-LVVVGAGCVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cy5-KAPAR-OH
Peptide Cy5-KAPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^YIHP^F^HL-OH
Peptide H-V^YIHP^F^HL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Human Papillomavirus E7 protein (49 - 57)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C52H77N15O13Molecular weight:1,120.29 g/molLCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2
Peptide LCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRDTDLPFELRGELV-NH2
Peptide H-CRDTDLPFELRGELV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 135 (PKRRRHRQDALPGPC)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,787.1 g/molBiot-KKKSPGEYVNIEFG-NH2
Peptide Biot-KKKSPGEYVNIEFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AGRSL-NH2
Peptide Ac-AGRSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLPSSIEK^-OH
Peptide H-GLPSSIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DYVSQFEGSALGK^^^-OH
Peptide H-DYVSQFEGSALGK^^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTNWIQK^-OH
Peptide H-YTNWIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phytochelatin 2 (PC2)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C18H29N5O10S2Molecular weight:539.58 g/molH-CRQIKIWFQNRRMKWKK-NH2
Peptide H-CRQIKIWFQNRRMKWKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[pGlu3]-Amyloid-β Protein (3-42) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:4,309.9 g/molThr-Val-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C18H27N3O5Molecular weight:365.42 g/molCMVpp65 - 10 (HETRLLQTGIHVRVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,746 g/molAc-ARTKQTARKSTGGKA-NH2
Peptide Ac-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CDYEFEKHINLDQ-NH2
Peptide Ac-CDYEFEKHINLDQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
