Peptides
Subcategories of "Peptides"
Found 29635 products of "Peptides"
Mob-S-Mercaptoproprionic acid
Mob-S-Mercaptoproprionic acid is a reagent that can be used to synthesize peptides. It is also a Building Block for the synthesis of other molecules. Mob-S-Mercaptoproprionic acid is hydrolyzed to form the corresponding carboxylate and mercaptoacyl amide, which can be used in peptide synthesis by condensation with an amino acid.
Formula:C11H14O3SPurity:Min. 95%Molecular weight:226.3 g/molH-LLIYY^TSR^-OH
Peptide H-LLIYY^TSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVLGQLGITK-OH
Peptide H-SVLGQLGITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-KRMKVAKNAQ-OH
Peptide Myr-KRMKVAKNAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAQAGRQKKPVTYLEDSDDDF-OH
Peptide Ac-CAQAGRQKKPVTYLEDSDDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-YPYDVPDYAS-NH2
Peptide Ac-YPYDVPDYAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPEATPTELAK^-OH
Peptide H-LPEATPTELAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Color and Shape:PowderBoc-L-Glutamic Acid bis-Propargyl Amide
Boc-L-Glutamic Acid bis-Propargyl Amide is a building block for Click Chemistry. It is a white solid that is soluble in DMF, DMSO and other organic solvents. This product can be used as a reagent for peptide synthesis and as an intermediate for the synthesis of amino acids. Boc-L-Glutamic Acid bis-Propargyl Amide reacts with dimethylaminoethanol to form the corresponding amide. It has been shown that this product can be used in click chemistry reactions to form amides and ureas.Formula:C16H23N3O4Purity:Min. 95%Molecular weight:321.3 g/molBiot-KAGFFKRQYKSILQEENRRDSWSYINSKSNDD-OH
Peptide Biot-KAGFFKRQYKSILQEENRRDSWSYINSKSNDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GpTX-1 Toxin
GpTX-1 is a synthetic 34 amino acid peptide derived from tarantula spider venom. Due to its antagonist activitiy against voltage gated sodium channels such as Na v1.7, it can be used as a possible therapeutic in inflammatory, neuropathic, visceral and nociceptive pain treatment. DpTX-1 has also been found to block voltage-dependent calcium channels.
One-Letter Formula: H-DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2Formula:C176H271N53O45S7Purity:Min. 95%Molecular weight:4,073.9 g/molH-GLKEIFKAGLGSLVKGIAAHVAS-NH2
Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Trp-Phe-OH
CAS:H-Trp-Phe-OH is a chromatographic, ligand, and mass spectrometric compound that has a red shift in its fluorescence spectrum. It has been shown to have anti-cancer properties by blocking the cell cycle at the G2/M phase. The red shift of the fluorescence spectrum is due to the presence of two isomeric forms that have different optical properties. H-Trp-Phe-OH has been analysed for its effects on cancer cells and was found to inhibit growth and induce apoptosis in mononuclear leukemia cells.
Formula:C20H21N3O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:351.4 g/molLixisenatide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C215H347N61O65SMolecular weight:4,858.49 g/molFluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH
Peptide HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MOCAc-Pro-Leu-Gly
CAS:MOCA-Pro-Leu-Gly is a peptide that can bind to the receptor for the neurotransmitter acetylcholine. It is a competitive inhibitor of acetylcholine and has been shown to have an affinity for the nicotinic acetylcholine receptor (nAChR) in vitro. MOCA-Pro-Leu-Gly has been used as a research tool to study protein interactions, as well as to investigate the function of ion channels and receptors. This peptide also has potential therapeutic uses, such as treating Alzheimer's disease by blocking nicotinic acetylcholine receptors in the brain.Formula:C25H31N3O8Purity:Min. 95%Molecular weight:501.53 g/molUrokinase-Derived Peptide A6
Urokinase-Derived Peptide A6 (UDP-A6) is a protein derived from the urokinase enzyme. It has been shown to have antiproliferative effects on tumour cells and has been studied as a potential treatment for inflammatory diseases such as rheumatoid arthritis. The mechanism of action is not fully understood, but it is thought that UDP-A6 binds to a specific receptor on the surface of cells, called the leukocyte antigen, which causes them to stop proliferating. UDP-A6 has also been shown to bind to the surface glycoprotein of cancer cells and cause them to die.Formula:C39H62N10O15Purity:Min. 95%Molecular weight:910.99 g/molPremelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolSuc-Ala-Pro-Ala-pNA
CAS:Suc-Ala-Pro-Ala-pNA is a synthetic substrate that inhibits serine proteases. It has been shown to inhibit thrombin, trypsin, and chymotrypsin at low concentrations. Suc-Ala-Pro-Ala-pNA is used as an anticoagulant in rat neutrophils and it has also been found to have chemotactic activity for neutrophils at high concentrations. The substrate was also found to be an efficient method of detecting the presence of protease activity in plant physiology experiments. In addition to its use as a proteinase inhibitor, Suc-Ala-Pro-Ala-pNA can also be used as an antiplatelet agent.Formula:C21H27N5O8Purity:Min. 95%Molecular weight:477.47 g/molH-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DPKSAAQNSKPRLSFSTKC-NH2
Peptide Ac-DPKSAAQNSKPRLSFSTKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Antipain
CAS:Antipain is a protease inhibitor, which is derived from microbial sources. It inhibits serine and cysteine proteases through the formation of a reversible covalent complex with the active site of the enzyme. This interaction effectively prevents the proteolytic activity of these enzymes, thereby modulating various biological processes.The primary application of Antipain is in biochemical research where it is utilized to study protease function and regulation. By inhibiting specific proteases, researchers can investigate protein degradation pathways and decipher complex signaling mechanisms. Additionally, Antipain is used experimentally to inhibit protease activity in cell lysates, thereby preserving protein integrity during sample preparation. Its specificity for serine and cysteine proteases makes it a valuable tool for differentiating between proteolytic activities in various biological samples.Formula:C27H44N10O6netPurity:Min. 95%Molecular weight:604.7 g/mol5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Molecular weight:2,012.1 g/molMeOSuc-Ala-Ala-Pro-Met-AMC
CAS:MeOSuc-Ala-Ala-Pro-Met-AMC is a substrate for the aminopeptidase. It has been shown to have minimal effects on intestinal cells and analyzed peptidases, proteolytic peptidases, and aminopeptidases. This compound is not pathogenic and can be used as a modulator of oncospheres and parasites.Formula:C31H41N5O9SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:659.75 g/molBiot-RKRSRAE-OH
Peptide Biot-RKRSRAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPNALTDDR^-OH
Peptide H-VPNALTDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KIPNPDFFEDLEPFR^-OH
Peptide H-KIPNPDFFEDLEPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo[Arg-Ala-Asp-D-Phe-Lys(Ac-SCH2CO)]
Cyclo[Arg-Ala-Asp-D-Phe-Lys(Ac-SCH2CO)] is a peptide that is derived by the sequential removal of amino acids from the C-terminal end of the RGD sequence. This peptide has been shown to interact with integrin αvβ3 and inhibit tumor cell proliferation and migration. Cyclo[Arg-Ala-Asp-D-Phe-Lys(Ac-SCH2CO)] also inhibits production of inflammatory cytokines by inhibiting NFκB signaling pathways.Formula:C32H47N9O9SPurity:Min. 95%Molecular weight:733.85 g/molδ Sleep Inducing Peptide
Peptide Delta Sleep Inducing Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C35H48N10O15Molecular weight:848.83 g/molGAD65 (206-220)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C86H129N15O24Molecular weight:1,757.07 g/molSIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,695 g/molH-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGEVIVTK^-OH
Peptide H-VGEVIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Asp(OtBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Asp(OtBu)-Wang resin is a 1% DVB resin that can be used as an inhibitor of peptide synthesis. It has been shown to selectively inhibit the binding of the L-type calcium channel, which is a cell membrane protein that affects the transport of calcium ions in and out of cells. Fmoc-Asp(OtBu)-Wang resin binds to the receptor site, preventing the natural ligand from binding. This inhibition prevents the activation of ion channels and reduces calcium ion influx into cells, leading to an anti-inflammatory effect.Purity:Min. 95%SH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C66H97N12O24PMolecular weight:1,473.57 g/molH-Glu-Glu-Leu-OH
CAS:H-Glu-Glu-Leu-OH is a vitamin that is essential for the production of hydroxyproline, which aids in the formation of collagen. It is also used to treat osteoarthritis and rheumatoid arthritis. H-Glu-Glu-Leu-OH is synthesized from glutamate, glutamic acid, and leucine in the liver and kidney. This reaction proceeds by two steps: first, glutamate carboxylase converts glutamate to α-ketoglutarate; then, aspartate aminotransferase converts α-ketoglutarate to aspartate semialdehyde. Aspartate semialdehyde is converted to H-Glu-Glu-Leu by an enzyme called glutamyl aminopeptidase. The reaction mechanism of this enzyme has been studied experimentally and theoretically using sodium bicarbonate (NaHCO) as a buffer. The sequential natureFormula:C16H27N3O8Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:389.40 g/molH-YGIDWASGR^-OH
Peptide H-YGIDWASGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-VLPQDKEYYKVKEPGE-NH2
Peptide LCBiot-VLPQDKEYYKVKEPGE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Asp(Lys-OH)-OH
CAS:H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).Formula:C10H19N3O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:261.28 g/molCyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C13H24N4O6S1Molecular weight:364.42 g/molNeuropeptide K
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C175H284N52O52SMolecular weight:3,980.4 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPFPIIDDR^-OH
Peptide H-LPFPIIDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPMSPR^-OH
Peptide H-DLPMSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MOG (92-106)
MOG (92-106) is a peptide that is derived from myelin basic protein. It has been shown to be immunogenic and can induce the production of antibodies in animals. MOG (92-106) also induces demyelination in mice.Formula:C80H104N21O27SPurity:Min. 95%Molecular weight:1,823.91 g/molFmoc-Leu-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Leu-Wang Resin is a research tool that can be used to synthesize peptides. It is used as an activator and ligand in the production of antibodies, ion channels, and cell biology. The resin has a high purity and can be used for a variety of purposes such as pharmacology, protein interactions, and peptide synthesis. Fmoc-Leu-Wang Resin has been shown to inhibit the binding of many different proteins to their receptors.Purity:Min. 95%
![Cyclo[Arg-Ala-Asp-D-Phe-Lys(Ac-SCH2CO)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3959-PI.webp&w=3840&q=75)
