
Peptides
Subcategories of "Peptides"
Found 29633 products of "Peptides"
H-VVSVLTVTHQDWLNGK^-OH
Peptide H-VVSVLTVTHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPIESHQVEKR^-OH
Peptide H-TPIESHQVEKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAQELEEK^-OH
Peptide H-VAQELEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^GPLVEQGR^-OH
Peptide H-L^GPLVEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-9/aa33 - 47
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,827.1 g/molH-GPTGTGESKC-NH2
Peptide H-GPTGTGESKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Rph-NH2
Peptide Ac-Rph-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WEHR-OH
Peptide H-WEHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C28H36N10O6Molecular weight:626.66 g/molH-GPGPGGPGGAGVAR^-OH
Peptide H-GPGPGGPGGAGVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PSD95 peptide
PSD95 peptide is a PSD95 fragment. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C81H121N19O21Molecular weight:1,714.96 g/molH-EIPISINYR^-OH
Peptide H-EIPISINYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Asn670,Sta671,Va672)-Amyloid β/A4 Protein Precursor770 (662-675) ammonium salt
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C73H118N16O27Molecular weight:1,651.83 g/molTH006 - Tau degrader
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:3,780.1 g/molH-DGTFPLPIGESVTVTR^-OH
Peptide H-DGTFPLPIGESVTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-FEEERL-OH
Peptide Myr-FEEERL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SCDTPPPCPR-OH TFA salt
Peptide H-SCDTPPPCPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C43H67N13O14S2Molecular weight:1,072.22 g/molAc-DIEVLQEQIRC-NH2
Peptide Ac-DIEVLQEQIRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV QK10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C51H86N14O13SMolecular weight:1,135.4 g/molSIVmac239 - 10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,618.9 g/molH-LSPSFADLFR^-OH
Peptide H-LSPSFADLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Angiotensin III
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C46H66N12O9Molecular weight:931.1 g/molH-YLGEEYVK^^-OH
Peptide H-YLGEEYVK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSSVSGIFTFQK^-OH
Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolHXB2 gag NO-8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,928.3 g/molH-GLPSSI^EK^-OH
Peptide H-GLPSSI^EK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTEQGHELSNEER^-OH
Peptide H-AVTEQGHELSNEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Intermedin / Adrenomedullin-2 (Human) - I-125 Labeled
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolpE-RPRLSHKGPMPF-OH
Peptide pE-RPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:1,533.82 g/molCEA 605-613 mutant (HLA-A*02:01) 610D
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C43H68N10O15Molecular weight:965.08 g/molSIVmac239 - 38
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,769.1 g/molH-LALDNGGLAR^-OH
Peptide H-LALDNGGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATNATLDPR-NH2
Peptide H-ATNATLDPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GTPase NRas (55-64)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolThr-Met-Ile
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C15H29N3O5S1Molecular weight:363.47 g/molNeuropeptide Y, human, rat
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C189H285N55O57S1Molecular weight:4,271.74 g/molH-FSGEYIPTV^-OH
Peptide H-FSGEYIPTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,800.1 g/molH-VLNDILSR^L-OH
Peptide H-VLNDILSR^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^GP^L^VEQGR^-OH
Peptide H-L^GP^L^VEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-IWIAQELRRIGDEFNAYYARR-NH2
Peptide Ac-IWIAQELRRIGDEFNAYYARR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFFNIFTR^-OH
Peptide H-FFFNIFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LRPVAAEVYGTER^-OH
Peptide H-LRPVAAEVYGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVPLNTIIFMGR^-OH
Peptide H-EVPLNTIIFMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin Basic Protein (83-99) (bovine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C93H143N25O24Molecular weight:1,995.31 g/molAc-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DRLPKSDSEDGPRALNQLSC-NH2
Peptide Ac-DRLPKSDSEDGPRALNQLSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PKKKRKVEDPYC-OH
Peptide Ac-PKKKRKVEDPYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-COV-2 S Protein (934 - 947)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,377.53 g/molBlocking peptide for Neurogranin pAb (Prod. No. BML-NA1300)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,828.1 g/mol
