Peptides

<p>H-Thr-Phe-Arg-Gly-Ala-Pro-NH2 is a peptide that activates coagulation. It is a biologically active peptide and has been shown to activate protease activated receptor (PAR) peptides, PAR2, and PAR3. H-Thr-Phe-Arg-Gly-Ala-Pro-NH2 regulates hypertension by inhibiting the activity of angiotensin II type 1 receptors.</p>

<p>Peptide H-FAHTVVTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LKEFGNTLEDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LLGLSLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Beta-2 Microglobulin Human is a research tool that can be used to study the activation of receptors, ion channels, and protein interactions. It is a ligand that binds to cell surface receptors. It is also an inhibitor that blocks the formation of antibodies by binding to human immunoglobulin G (IgG) and prevents it from binding to antigens. Beta-2 Microglobulin Human is a high purity protein with a CAS number of 1768-01-7.</p>

<p>Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-KKKSPGEYVNIEFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This product is an antiserum targeting amino acids 37-43 of the amyloid beta-protein which is a key component of extracellular plaques found in the brains of patients with Alzheimer’s disease (AD). It may also be involved in the pathogenesis of other neurodegenerative diseases such as Huntington’s disease and Parkinson’s disease. Targeting this protein may be key to drug discovery and the treatment of AD and other diseases this protein is associated with. Furthermore amyloid beta peptides located in the cerebrospinal fluid are well known biomarkers used to diagnose AD. Although AD is not yet curable, an early diagnosis can be useful in that patients can be treated to delay or improve symptoms.<br>This product may also be used to detect amyloid beta protein in cell cultures, tissues, or fluids by immunohistochemistry or ELISA. It is suitable for use in life sciences, cell biology, and pharmacology studies.</p>

<p>Suc-Ala-Ala-Pro-Abu-pNA is a peptide that has been shown to inhibit the activity of elastase, an enzyme that breaks down proteins in tissues. It is used as a substrate for enzyme assays and as a tool for studying elastase. This peptide can be used to study the structure and function of elastases, which are necessary for the breakdown of proteins in tissues.</p>

<p>This peptide is a PAR1-specific agonist that has been shown to produce cardioprotective effects in experimental models of myocardial infarction. It is a potent inhibitor of platelet aggregation and coagulation, and was found to be an effective antithrombotic agent in animal models. The peptide is also a potent vasodilator with potential for the treatment of hypertension.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>IGF1 N15 Human is a desiccated, freeze-dried protein that is stable isotope and suitable for use in metabolic studies. IGF1 N15 Human has the same amino acid sequence as human insulin-like growth factor 1 (IGF1). IGF1 N15 Human can be used to study cell proliferation, sulfation, and sulfate conjugation. This protein is also used in Cytokines research as an alternative to recombinant human IGF1. Reconstitute with water or buffer prior to use.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Synthetic peptide used in treatment of prostrate cancer</p>

<p>Peptide H-K^VLEHVVRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-NQVSLTCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HKKKHPDASV^NFSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Rhod-IPMIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PDEVKRKKKPYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-PLARTLSVAGLPGKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Gln(Trt)-Rink-Amide MBHA Resin is a peptide resin that can be used as an activation and coupling agent for the synthesis of peptides. It is also used in the production of antibodies, and has been shown to inhibit ion channels. Fmoc-Gln(Trt)-Rink-Amide MBHA Resin is a high purity material with a CAS number, which can be used in research tools, cell biology, and pharmacology.</p>

<p>ProTx-II is a synthetic peptide that activates the TRPV1 receptor, a member of the capsaicin receptor family. ProTx-II has been shown to inhibit NGF-induced neurite outgrowth, and can be used as a research tool in studying the structure and function of TRPV1 receptors. ProTx-II is also an inhibitor of protein interactions with the TNF receptor, and has been shown to selectively inhibit NFκB activation by inhibiting IKK kinase activity.</p>

<p>Peptide Ac-QKRAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QPGITFIAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Trp(Boc)-Wang resin is a solid phase peptide synthesis resin that can be used to synthesize peptides. It contains an amino acid sequence of Trp-Boc-Wang, which has been shown to inhibit the activity of ion channels. Fmoc-Trp(Boc)-Wang resin is also a useful tool for studying protein interactions and receptor binding. This resin is manufactured by Applied Biosystems, Inc., and is available in 100-200 mesh size. The product comes with a 1% DVB content and purity of &gt;97%.</p>

<p>Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB is a high purity resin that is used as an ion channel blocker in research. It has been used to study the interactions between ligands and receptors, and is also used as a pharmacology research tool. This product has a CAS number of 61741-00-8.</p>

<p>Peptide LCBiot-NAPVISPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-V^YIHP^F^HL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TPVSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Cy5-KAPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AL^PAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SVPAFFWTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-ANISH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLKMPHWPHLLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-EEEPQEEIPYLELLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVVVGAGCVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-PKYVKQNTLKLAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Abz-EPFWEDQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mambalgin-1 is a natural product with an unknown pharmacophore. It has been shown to inhibit cancer cells in vitro and in vivo by suppressing the activation of suppressor genes, which are genes that regulate cell proliferation. Mambalgin-1 may also be effective against other diseases such as Parkinson's disease, Alzheimer's disease, and Huntington's disease. Mambalgin-1 is synthesized from a solid-phase synthesis of a cyclic peptide that contains two acidic amino acids. This synthetic compound binds to the extracellular region of synaptic vesicles and inhibits the release of neurotransmitters. The mechanism of action is not yet known, but it is thought that this compound may inhibit calcium channels or potassium channels in the presynaptic membrane.</p>