
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30332 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-ENQLEVLEVSWLHGLK^-OH
Peptide H-ENQLEVLEVSWLHGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Melanotan I
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C78H111N21O19Molecular weight:1,646.9 g/molAc-DLIEEAASRIVDAVIEQVKAAGAY-NH2
Peptide Ac-DLIEEAASRIVDAVIEQVKAAGAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-54/aa213 - 227
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,550.7 g/molH-IL^DTAGL^EEY-OH
<p>Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TESTLNALLQR^-OH
<p>Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C42H74N10O12SMolecular weight:943.18 g/molH-LDVHYAPTIR^-OH
<p>Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQVVR^-OH
<p>Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-YG-OH
<p>Peptide Fluor-YG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Dynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C99H155N31O23Molecular weight:2,147.5 g/molH-GSFPWQAK^-OH
<p>Peptide H-GSFPWQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PAFSAIR^-OH
<p>Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPSGPGPPSPTPPAPR^-OH
Peptide H-RPSGPGPPSPTPPAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CDSEPVLKGVKLHYT-OH
<p>Peptide Ac-CDSEPVLKGVKLHYT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSPVLIDFFEDTER^-OH
<p>Peptide H-DSPVLIDFFEDTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myr-RWKFGGFKWR-OH
<p>Peptide Myr-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLHGPLTLNSPLTPEK^-OH
<p>Peptide H-GLHGPLTLNSPLTPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-EEEEE-OH
Peptide Ac-EEEEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGGPEAGLGEYLFER^-OH
<p>Peptide H-LGGPEAGLGEYLFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH
<p>Peptide H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFADINLYR^-OH
<p>Peptide H-SFADINLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DKGSAYKPLTLNRSYVIRKC-NH2
Peptide Ac-DKGSAYKPLTLNRSYVIRKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice....CLEAR-OX
<p>Peptide ...CLEAR-OX is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>R5
<p>The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.</p>Molecular weight:2,012.1 g/molH2N-Gly-Pro-Leu-Gly-Val-Arg-Gly-Cys-COOH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C31H55N11O9S1Molecular weight:757.9 g/molH-VGVNGFGR^-OH
Peptide H-VGVNGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 18
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,625.8 g/molHIV - 1 MN ENV - 28
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,715.1 g/molH-LFGGFNSSDTVTSPQR^-OH
<p>Peptide H-LFGGFNSSDTVTSPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVSGVLSDQMSAR^-OH
<p>Peptide H-FVSGVLSDQMSAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AGGKAGKDSGKAKAKAVSR-OH
<p>Peptide Ac-AGGKAGKDSGKAKAKAVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSGDSSQVTQVSPQR^-OH
<p>Peptide H-GSGDSSQVTQVSPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Trp-Ile-Arg
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C23H35N7O4Molecular weight:473.57 g/molH-LPDA^TPTELA^K^-OH
Peptide H-LPDA^TPTELA^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 132 (AELEGVWQPAAQPKR)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,679.9 g/molH-SIINFEK^L-OH
<p>Peptide H-SIINFEK^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-EEPLYWSFPAKKK-NH2
Peptide 5Fam-EEPLYWSFPAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H2N-Ser-Cys-Arg-Trp-Arg-Phe-Pro-Ala-Arg-Pro-Gly-Th
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C63H96N22O15S1Molecular weight:1,433.64 g/molMyr-SIYRRGARRWRKL-OH
Peptide Myr-SIYRRGARRWRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEQQWNFAGIR^-OH
<p>Peptide H-TEQQWNFAGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NINNN-NHMe
Peptide H-NINNN-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RP^QQPYPQPQPQY-OH
<p>Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPDENFK^-OH
<p>Peptide H-FPDENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
<p>Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDAPIGK^-OH
<p>Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STEDTAEYSPFK^-OH
<p>Peptide H-STEDTAEYSPFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASGFTFMSSAVQWVR^-OH
<p>Peptide H-ASGFTFMSSAVQWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lys-Asp-Cys
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C13H24N4O6S1Molecular weight:364.42 g/molFE65
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
