Peptides

Boc-D-Ser(Bzl)-OH is a synthetic molecule that can be used in peptide synthesis. It is a potent inhibitor of galactose and tetrazole, and it inhibits the activities of enzymes involved in the synthesis of proteins, such as methionine synthase. Boc-D-Ser(Bzl)-OH has been shown to inhibit atherosclerotic lesions by blocking secretagogue activity and also inhibits the production of inflammatory mediators. This compound has potent inhibitory effects on piperidine.

<p>Lixisenatide is a peptide hormone that belongs to the class of dipeptidyl peptidase-4 inhibitors. It is used in the treatment of type 2 diabetes, including those with a body mass index (BMI) greater than 27 kg/m2 or who have had type 2 diabetes for more than 10 years. Lixisenatide reduces postprandial blood glucose levels by delaying gastric emptying and increasing glucagon-like peptide-1 (GLP-1) release. Lixisenatide has been shown to be effective in reducing cardiovascular events in people with congestive heart failure. Lixisenatide also has water vapor and cardiac effects that are similar to those of GLP-1 agonists.</p>

Fmoc-Asp(OtBu)-OH is a chemical compound that belongs to the group of modified amino acids. The synthesis of Fmoc-Asp(OtBu)-OH starts with the reaction of nicotinic acetylcholine, sodium carbonate, and chloride in trifluoroacetic acid. The product is then reacted with a disulfide bond and modified with polymerase chain and saponified. The final modification is achieved by reacting Fmoc-Asp(OtBu)-OH with messenger RNA (mRNA), which produces the desired product. Fmoc-Asp(OtBu)-OH has been shown to have minimal activity, as it does not elute from an ion exchange column under normal conditions. It also has no effect on acetylcholine release in rat hippocampal slices or on morphology when incubated in vitro for 24 hours at 37 degrees Celsius.

Peptide Ac-CAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FNKPFVFLMIEQNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>JAG-1(188-204). Jagged - 1 is a cell surface ligand for in the Notch pathway. Notch receptors and ligands are present on the extracellular service of cells and require cell-cell contact for engagement. Ligand binding to Notch receptors results in the proteolytic cleavage of membrane-bound Notch receptors, thus allowing the intercellular region to be transported to the nucleus and become a transcriptional activator. The ligand-induced Notch activation is regulated by E3 ubiquitin ligases, Mindbomb1 (Mib-1) and Neuralized.JAG1 is widely expressed throughout mammalian development, across many tissues and developmental stages. Notch signalling plays a critical role in cellular fate determination including muscle cell differentiation, neurogenesis, and the development of the sensory regions of the inner ear- heart- kidney- eye- lung and other tissues.Jag-1 has been implicated in breast- cervical- colorectal- endometrial- gastric- head and neck- ovarian- hepatocellular- lung- pancreatic- prostate, and kidney and adrenocortical cancers, leukemia and lymphoma. Co-overexpression of Notch-1 and Jagged-1 predicts the poorest overall cancer survival. JAG1 mutations have also been associated Alagille syndrome.</p>

<p>Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Arg(Pbf)-OH is an amido-resin that is used in the industrial preparation of polyamides and as a reactive component for the synthesis of various peptide or protein drugs. The polymerisation reaction leads to the formation of a linear chain with a high molecular weight and low viscosity. Fmoc-Arg(Pbf)-OH has been used as an envisaged component for the synthesis of acetylcholine, messenger RNA, and nicotinic acetylcholine receptor. Trifluoroacetic acid is commonly used as a solvent in this process.</p>

Peptide Ac-GGLVQPGGSLRLSCAASGFTF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EDLAALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc-Ser(tBu)-Gly-OH is a building block for the synthesis of dipeptides. It contains a free amino group and can be used to synthesize peptides containing serine and glycine. This reagent can also be used in the synthesis of other dipeptides, such as Fmoc-Leu-OH, Fmoc-Phe-OH, and Fmoc-Ile-OH.

<p>Uroguanylin (Human) product containing the disulfide bonds: Cys4-Cys12 and Cys7-Cys15 and avaialable in the trifluoroacetate salt form. Uroguanylin is a peptide hormone that is involved in the regulation of fluid and electrolyte balance in the body. It is produced in the intestinal tract, specifically in the lining of the small intestine and colon.<br>Uroguanylin belongs to a family of peptides that includes guanylin and the heat-stable enterotoxins (STs).These peptides all share a similar structure and function, as they bind to and activate the guanylate cyclase-C (GC-C) receptor in intestinal cells.<br>Activation of GC-C by uroguanylin leads to an increase in cyclic GMP (cGMP) levels, which in turn activates a variety of downstream signaling pathways. This leads to an increase in chloride and bicarbonate secretion in the intestine, as well as an increase in intestinal fluid secretion. Uroguanylin also stimulates sodium and water reabsorption in the kidneys, leading to an increase in urine output.<br>Uroguanylin has been studied for its potential therapeutic applications, particularly in the treatment of gastrointestinal disorders. For example, synthetic analogs of uroguanylin are being developed as potential treatments for constipation and other disorders of intestinal motility. Additionally, uroguanylin has been shown to have anti-inflammatory properties and may be useful in the treatment of inflammatory bowel disease.</p>

Please enquire for more information about Fmoc-Glu(OtBu)-OH•H2O including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Boc-Arg(NO2)-OH is an activated molecule that is used as an anticoagulant. It inhibits the serine protease, which has an inhibitory effect on heparin-induced thrombocytopenia, and also inhibits platelet aggregation. Boc-Arg(NO2)-OH has been shown to have a potent inhibition of the enzyme that converts prothrombin into thrombin. This effect can be reversed by adding protamine sulfate. The clinical data suggest that this drug may be beneficial for patients with severe or life-threatening conditions who are taking heparin therapy or undergoing surgery and need anticoagulation. The prognosis of this drug is unclear, but it appears to be safe when administered in conjunction with other medications such as aspirin and warfarin.</p>

<p>Peptide H-VPAINVNDSVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WYQSMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>inhibitor of chymotrypsin-like activity of the multicatalytic proteinase complex in HT4 cells.  Causes accumulation of ubiquitinylated proteins in neuronal cells.</p>

<p>This is a synthetic peptide that mimics the endogenous human epidermal growth factor (EGF) and binds to the toll-like receptor. It has been shown to stimulate physiological function in experimental models of bowel disease and cardiac disease, as well as cancer tissues. The peptide also binds to the guanine nucleotide-binding protein, polymerase chain reaction, and inflammatory bowel disease genes. In vivo studies have confirmed that this peptide enhances the production of EGF in maternal blood and stimulates squamous carcinoma growth in an animal model.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. The nucleoprotein has a critical role in virus assembly and RNA transcription. The nucleoprotein is essential in the formation of helical ribonucleoproteins and in regulating viral RNA synthesis. The nucleoprotein can also regulate infected host cellular mechanisms. It is highly expressed during infection and may induce protective immune responses against SARS-CoV and SARS-CoV-2.The nucleoprotein residues GMEVTPSGTWLTYTG (321-335) from SARS-CoV-2 have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.</p>

<p>Peptide H-GLQTSQDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Boc-Glu(OBzl)-OH is a peptide that inhibits the enzyme adenylate kinase. It binds to the ATP binding site on the enzyme and blocks access of the substrate, ADP, to its catalytic site. This prevents ATP from being converted into AMP, which is needed for cellular energy production. Boc-Glu(OBzl)-OH has been used in research as an inhibitor in cell biology and pharmacology studies.<br>The purified product is supplied at high purity with low endotoxin levels.</p>

Peptide H-LSITIRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>A synthetic spider venom toxin sourced from the Papua New Guinean Spider, Nephila maculata. This product may have potential in pharmaceutical applications, such as in ion channel research.</p>

<p>Peptide PEPTIDE 1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Dap3-Ghrelin is a Ghrelin related peptide and is the active fragment of Ghrelin that binds to Ghrelin receptors with high affinity and activates the same signaling pathway as endogenous ghrelin. This product can be used in the study of obesity as Ghrelin has been shown to be a hormone that stimulates appetite and meal initiation. It could also play a role in gaining a further understanding into diabetes as Ghrelin has been found to stimulate insulin release.</p>

Peptide LCBiot-RLDGNEIKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Pancreatastatin is a peptide hormone that inhibits energy metabolism. Pancreatastatin is a biologically active peptide that has been isolated from the pancreas and shown to have effects on the endocrine system, including regulation of feeding behavior. Pancreatastatin is also known as somatostatin and is found in both animals and humans. Pancreatastatin has been shown to inhibit cellular proliferation and decrease tumor size in animal models of cancer, as well as to regulate blood sugar levels in diabetic patients. Pancreatastatin is also used for treating bowel diseases such as colitis.

<p>MCA conjugated molecule targeting furin</p>

<p>Peptide H-TFPGFFSPMLGEFVSETVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-Arg-Gly-Lys-MCA is a histone deacetylase inhibitor that belongs to the class of peptides. This drug has been shown to inhibit the activity of histone deacetylases and can be used for the treatment of diabetes. Ac-Arg-Gly-Lys-MCA is an enzyme substrate, which means it is not active when taken orally. It must be administered intravenously or intraperitoneally in order to be metabolized by enzymes in the body.</p>

<p>Fibronectin Adhesion-Promoting Peptide is a polyclonal antibody that recognizes fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin promotes cell adhesion and proliferation by binding to collagen. This antibody can be used to detect fibronectin in tissues from patients with cancer. It may also be used as a tool for identifying cancer cells that have metastasized to other sites in the body.</p>

Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Eptifibatide is a drug that is used in the treatment of congestive heart failure, acute coronary syndrome and peripheral artery disease. It is a glycoprotein IIb/IIIa inhibitor that binds to integrin receptors on platelets and prevents them from binding to fibrinogen. This prevents blood clotting and reduces the risk of stroke or heart attack. Eptifibatide has been shown to be effective for the treatment of bowel disease, infectious diseases, and experimental models of myocardial infarcts. The drug has significant cytotoxicity, which may be due to its ability to inhibit cell proliferation by blocking protein synthesis at the ribosome level.<br>Eptifibatide has been shown to have a disulfide bond between two cysteine residues located in its amino-terminal region. This bond stabilizes the molecule in solution and ensures that it remains active until it reaches its target site.</p>

Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>E-64-d is a research tool that is used in cell biology, pharmacology, and biochemistry to study protein interactions. E-64-d is an activator, ligand, or receptor for ion channels and has been shown to inhibit the activity of high purity K+ channels. This peptide binds to the extracellular loop of voltage-gated potassium channels (Kv1.2) and inhibits the opening of these channels by blocking their access to ATP. E-64-d also binds to an antibody as a competitive inhibitor of the antigen binding site on the antibody.</p>

<p>Caloxin 2A1 is a peptide that has been shown to activate the receptor for bradykinin, a peptide hormone that causes vasodilation. The activation of this receptor by Caloxin 2A1 leads to the opening of ion channels in the cell membrane, which causes an influx of calcium ions into the cell. This influx activates enzymes that break down proteins and increases the permeability of blood vessels. Caloxin 2A1 also inhibits ligand-induced activation of phospholipase C. Caloxin 2A1 binds to an antibody against bradykinin, which can be used as a research tool or as a means to measure levels of bradykinin in blood plasma.<br>Caloxin 2A1 has a molecular weight of 543 g/mol and CAS number 350670-85-8.</p>

<p>Peptide H-FAGVFHVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Trans-Cinnamoyl-Tyr-Pro-Gly-Lys-Phe-NH2 is a cardiac peptide that belongs to the class of PAR4 and PAR1 receptor agonists. It has been shown to be an endogenous agonist of both PAR4 and PAR1 receptors, which are involved in blood pressure regulation. Trans-Cinnamoyl-Tyr-Pro-Gly-Lys-Phe-NH2 has been shown to activate these receptors in vivo, leading to increased blood pressure. Additionally, it has been shown to have a cardioprotective effect by decreasing myocardial infarct size in rats.

<p>Peptide H-VGLPISQ^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.