Peptides
Subcategories of "Peptides"
Found 30060 products of "Peptides"
H-TAATNAACA-OH
Peptide H-TAATNAACA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPPPKVIQ-OH
Peptide H-FPPPKVIQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVQEIQATFFYFTPNKTEDTIFLR-OH
Peptide H-SVQEIQATFFYFTPNKTEDTIFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RALGPGATL-OH
Peptide H-RALGPGATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FAFRDLCIVY-OH
Peptide H-FAFRDLCIVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIHKQKEKSR-OH
Peptide H-GIHKQKEKSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QPAPENAYQAY-OH
Peptide H-QPAPENAYQAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGF-OH
Peptide H-YGGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSLQPLALEGSLQKR-OH
Peptide H-GSLQPLALEGSLQKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KQTARKSTGGKC-OH
Peptide H-KQTARKSTGGKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKKKKKKKK-OH
CAS:Peptide H-KKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C54H110N18O10Molecular weight:1,171.6 g/molH-TFSDLWKLL-OH
Peptide H-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNTANST-OH
Peptide H-VNTANST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YNLRRGIAL-OH
Peptide H-YNLRRGIAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WRERQRQIRSISGWI-OH
Peptide H-WRERQRQIRSISGWI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KSSAYSLQMGATAIKQVKKLFKKWGW-OH
Peptide H-KSSAYSLQMGATAIKQVKKLFKKWGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLADTVVAC-OH
Peptide H-GLADTVVAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGRPEWWMDYQKRYG-OH
H-VGRPEWWMDYQKRYG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C91H127N25O23SMolecular weight:1,971.22 g/molH-NLNSVSVPR-OH
Peptide H-NLNSVSVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVTLISFGAFVAK-OH
Peptide H-IVTLISFGAFVAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HYNPSLK-OH
Peptide H-HYNPSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KWKLFKKIGAVLKVL-NH2
Peptide H-KWKLFKKIGAVLKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C89H152N22O15Molecular weight:1,770.32 g/molH-MMMMMMMMMMMM-OH
Peptide H-MMMMMMMMMMMM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YNSGK-OH
Peptide H-YNSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEGDGVYTLNDK-OH
Peptide H-TEGDGVYTLNDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVLTLNFQ-OH
Peptide H-GVLTLNFQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVVPHDFRI-OH
H-GVVPHDFRI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C48H74N14O12Molecular weight:1,039.2 g/molH-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-DSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN-OH
Peptide H-DSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2
CAS:Peptide H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPRPK-OH
Peptide H-GPRPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C140H214N36O43Molecular weight:3,089.45 g/molH-RDHMVLHEYVNAAGIT-OH
Peptide H-RDHMVLHEYVNAAGIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFGNPFEPQAR-OH
Peptide H-SFGNPFEPQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSFFLYSKLTVD-OH
Peptide H-GSFFLYSKLTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLFGEPKRL-OH
Peptide H-FLFGEPKRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTYLTDETHR-OH
Peptide H-GTYLTDETHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVMEKNIVL-OH
Peptide H-AVMEKNIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENQLEVLEVSWLHGLK-OH
Peptide H-ENQLEVLEVSWLHGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RVRELAVAL-OH
Peptide H-RVRELAVAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFLGERVTL-OH
Peptide H-AFLGERVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIRHNPTGAVLFMGQINKP-OH
H-FIRHNPTGAVLFMGQINKP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C98H154N28O24S1Molecular weight:2,140.54 g/molH-DGRGD-OH
Peptide H-DGRGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLDFVRMGV-OH
Peptide H-LLDFVRMGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TNEFSLVNVNLQGCC-OH acetate salt
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-VAELVHFLL-OH
H-VAELVHFLL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GCRDGDQGIAGFDRCG-OH
Peptide H-GCRDGDQGIAGFDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDGREHTV-OH
Peptide H-YDGREHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPKPIPGNW-OH
Peptide H-DPKPIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TESTTEST-OH
Peptide H-TESTTEST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
