Peptides
Subcategories of "Peptides"
Found 29796 products of "Peptides"
H-LDSIICVK-OH
Peptide H-LDSIICVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLDALQAIK-OH
Peptide H-VLDALQAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FAVP-OH
Peptide H-FAVP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYTSGEACL-OH
Peptide H-TYTSGEACL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-FYVQALLR-OH
Peptide H-FYVQALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEITPYKPTW-OH
Peptide H-VEITPYKPTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNLAGNHEQEFLR-OH
Peptide H-FNLAGNHEQEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C194H295N55O57Molecular weight:4,309.81 g/molH-QEEEEDEDEER-OH
Peptide H-QEEEEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLKDAIKDL-OH
Peptide H-VLKDAIKDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFASLSELHCDK-OH
Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFA-OH
Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAIPTNFTI-OH
Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNYMYAR-OH
Peptide H-NNYMYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HP-OH
Peptide H-HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFDQIDNAPEEK-OH
Peptide H-AFDQIDNAPEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALYLQQNW-OH
Peptide H-IALYLQQNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C55H81N13O14Molecular weight:1,148.32 g/molH-GERIVDII-OH
Peptide H-GERIVDII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFSWASVTSK-OH
Peptide H-TFSWASVTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGSGLVGR-OH
Peptide H-SGSGLVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TWSKVGGHLRPGIVQSG-OH
Peptide H-TWSKVGGHLRPGIVQSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALTNSVNEALLNPSR-OH
Peptide H-IALTNSVNEALLNPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RMPEAAPPV-OH
Peptide H-RMPEAAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYVHPF-OH
Peptide H-VYVHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C203H311N55O60SMolecular weight:4,514.1 g/molH-GCTVHG-OH
Peptide H-GCTVHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MEVDPIGHLY-OH
Peptide H-MEVDPIGHLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C53H80N12O16SMolecular weight:1,173.35 g/molH-CSTGSIDMVD-OH
Peptide H-CSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TRFASVYAW-OH
Peptide H-TRFASVYAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QLSESQVK-OH
Peptide H-QLSESQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIQTAVR-OH
Peptide H-EIQTAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVPI-OH
Peptide H-AVPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQGISAEPQTYR-OH
Peptide H-AQGISAEPQTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSGSPNPAR-OH
Peptide H-DSGSPNPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSDIAGTTSTLQEQIGWMTN-OH
Peptide H-GSDIAGTTSTLQEQIGWMTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIWDNMTWMEWEREI-OH
Peptide H-EIWDNMTWMEWEREI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFIDFVAR-OH
Peptide H-YFIDFVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLFER-OH
Peptide H-LLFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQTAPVPMPDLK-OH
Peptide H-LQTAPVPMPDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENAEYLRVA-OH
Peptide H-ENAEYLRVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGDTSLDPNDFDFTVTGR-OH
Peptide H-VGDTSLDPNDFDFTVTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLTPRCNTAWN-OH
Peptide H-SLTPRCNTAWN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Bid BH3 Peptide
Peptide Bid BH3 Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C95H161N33O32SMolecular weight:2,309.61 g/molH-EHVAAVAGEPQPASCLSR-OH
Peptide H-EHVAAVAGEPQPASCLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CDDYYYGFGCNKFGRPRDD-OH
Peptide H-CDDYYYGFGCNKFGRPRDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPNALTDDR-OH
Peptide H-VPNALTDDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILQQLLFI-OH
Peptide H-ILQQLLFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IKEFLQRFIHIVQSIINTS-OH
Peptide H-IKEFLQRFIHIVQSIINTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
