Peptides
Subcategories of "Peptides"
Found 29795 products of "Peptides"
H-IGGIGTVPVGR-OH
Peptide H-IGGIGTVPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAMSQVTNSATIMMQ-OH
Peptide H-EAMSQVTNSATIMMQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVVPHDFRI-OH
H-GVVPHDFRI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C48H74N14O12Molecular weight:1,039.2 g/molH-KRQDILDLWIY-OH
Peptide H-KRQDILDLWIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RDDP-OH
Peptide H-RDDP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HPVGEADYFEY-OH
Peptide H-HPVGEADYFEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPRWYFYYL-OH
Peptide H-SPRWYFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GLFIIDGK-OH
Peptide H-GLFIIDGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVNELTEFAK^-OH
Peptide H-LVNELTEFAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFHGDAEAL-OH
Peptide H-AFHGDAEAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLQEAAEER-OH
Peptide H-GLQEAAEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2
CAS:Peptide H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIGLMVGGV-OH
Peptide H-IIGLMVGGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QQTVGGVNYFFDVEVGR-OH
Peptide H-QQTVGGVNYFFDVEVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IRILQQLL-OH
Peptide H-IRILQQLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NKIVRMYSPVSILDI-OH
Peptide H-NKIVRMYSPVSILDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGEATDGARPQALPEPMQESK-OH
Peptide H-SGEATDGARPQALPEPMQESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LISVDTEHSNIYLQNGPDR-OH
Peptide H-LISVDTEHSNIYLQNGPDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLPEYGGTK-OH
Peptide H-VLLPEYGGTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF-OH
Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESNGPVKVWGSIK-OH
Peptide H-ESNGPVKVWGSIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQAPLPCVL-OH
Peptide H-SQAPLPCVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TYQRTRAL-OH
Peptide H-TYQRTRAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSPLLRYAAWTGGLA-OH
Peptide H-TSPLLRYAAWTGGLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRREILSRRPSYR-OH
Peptide H-KRREILSRRPSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PQAPWM-OH
Peptide H-PQAPWM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IIDNKPSIDSYSK-OH
Peptide H-IIDNKPSIDSYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YALYDATYETK-OH
Peptide H-YALYDATYETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPSAPPQWLTNT-OH
Peptide H-YPSAPPQWLTNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPTDSELAPR-OH
Peptide H-LPTDSELAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALYYLQIHPQELR-OH
Peptide H-ALYYLQIHPQELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HHHAGYEQF-OH
Peptide H-HHHAGYEQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDKNADGWIEFEEL-OH
Peptide H-GDKNADGWIEFEEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PYNK-OH
Peptide H-PYNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPRPK-OH
Peptide H-GPRPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APQPELPYPQPGS-OH
Peptide H-APQPELPYPQPGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIPAWVPFDPAAQITK-OH
Peptide H-EIPAWVPFDPAAQITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPPLSQEAFADLWKK-OH
Peptide H-EPPLSQEAFADLWKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:1,759 g/molH-VGTQFTR-OH
Peptide H-VGTQFTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVPIAVQAVAK-OH
Peptide H-NVPIAVQAVAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A
Peptide H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RKLPDAPGMHTW-OH
Peptide H-RKLPDAPGMHTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VQAAVGTSAAPVPSDNH-OH
Peptide H-VQAAVGTSAAPVPSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EYFYTSGK-OH
Peptide H-EYFYTSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C140H214N36O43Molecular weight:3,089.45 g/molH-KAGQVVTIW-OH
Peptide H-KAGQVVTIW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YESIRIGVAPSQ-OH
Peptide H-YESIRIGVAPSQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYDFAFRDL-OH
Peptide H-VYDFAFRDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGIQNSVSA-OH
Peptide H-CGIQNSVSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
