Peptides
Subcategories of "Peptides"
Found 29707 products of "Peptides"
H-FAVNPGLLETSEGCR-OH
Peptide H-FAVNPGLLETSEGCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVYYGVPVWK-OH
Peptide H-TVYYGVPVWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAHKSEVAHRFKDLGEENFKALVL-OH
Peptide H-DAHKSEVAHRFKDLGEENFKALVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGTLGHPGSLDDTTYER-OH
Peptide H-SGTLGHPGSLDDTTYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEGAGEEQAAK-OH
Peptide H-VEGAGEEQAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPNGRGD-OH
Peptide H-VPNGRGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVLTIDK-OH
Peptide H-AVLTIDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVAVSQVAR-OH
Peptide H-SVAVSQVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGRFYIQM-OH
Peptide H-IGRFYIQM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFNGGP-NH2
Peptide H-SFNGGP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C25H36N8O8Molecular weight:576.6 g/molH-ILDDNLYKV-OH
Peptide H-ILDDNLYKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLRGRAYGL-OH
Peptide H-FLRGRAYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALVLIAFAQYLQQCPFEDHVK-OH
Peptide H-ALVLIAFAQYLQQCPFEDHVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C114H173N27O30SPurity:(%) Min. 95%Molecular weight:2,433.9 g/molH-EIQTAVR-OH
Peptide H-EIQTAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AMHVAQPAVVLASSR-OH
Peptide H-AMHVAQPAVVLASSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGDW-OH
Peptide H-RGDW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KYF-OH
Peptide H-KYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:456.5 g/molH-QLSESQVK-OH
Peptide H-QLSESQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-FEGDTLVNR-OH
Peptide H-FEGDTLVNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TRFASVYAW-OH
Peptide H-TRFASVYAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FYAEATPML-OH
Peptide H-FYAEATPML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CSTGSIDMVD-OH
Peptide H-CSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MEVDPIGHLY-OH
Peptide H-MEVDPIGHLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C53H80N12O16SMolecular weight:1,173.35 g/molH-GCTVHG-OH
Peptide H-GCTVHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYQNKVVKVL-OH
Peptide H-TYQNKVVKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVEGAGSIAAATGFVK-OH
Peptide H-TVEGAGSIAAATGFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C203H311N55O60SMolecular weight:4,514.1 g/molH-VYVHPF-OH
Peptide H-VYVHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RMPEAAPPV-OH
Peptide H-RMPEAAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTYEAYVRY-OH
Peptide H-YTYEAYVRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALTNSVNEALLNPSR-OH
Peptide H-IALTNSVNEALLNPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TWSKVGGHLRPGIVQSG-OH
Peptide H-TWSKVGGHLRPGIVQSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSLEGSR-OH
Peptide H-FSLEGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGSGLVGR-OH
Peptide H-SGSGLVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TFSWASVTSK-OH
Peptide H-TFSWASVTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FDDF-OH
Peptide H-FDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GERIVDII-OH
Peptide H-GERIVDII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IALYLQQNW-OH
Peptide H-IALYLQQNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C55H81N13O14Molecular weight:1,148.32 g/molH-AAGTVFTTVEDLGSKILLTC-OH
Peptide H-AAGTVFTTVEDLGSKILLTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFDQIDNAPEEK-OH
Peptide H-AFDQIDNAPEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HP-OH
Peptide H-HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CKMFVSEKKETASGD-OH
Peptide H-CKMFVSEKKETASGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQELESETLK-OH
Peptide H-FQELESETLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRHDSGYEVHHQ-OH
Peptide H-FRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NNYMYAR-OH
Peptide H-NNYMYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAIPTNFTI-OH
Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLCLRFLSK-OH
Peptide H-KLCLRFLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFA-OH
Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFASLSELHCDK-OH
Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
