Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 29706 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-ELLHAPATV-OH
Peptide H-ELLHAPATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAAAAAAAAA-OH
Peptide H-AAAAAAAAAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLPEVEVPQHL-OH
H-RLPEVEVPQHL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C59H97N17O17Molecular weight:1,316.52 g/molH-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Molecular weight:4,240.7 g/molH-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH
CAS:H-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C149H221N37O49Molecular weight:3,314.61 g/molH-KAIETDKEYYTVKD-OH
Peptide H-KAIETDKEYYTVKD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFSVSLSNPSTGK-OH
Peptide H-VFSVSLSNPSTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDS-NH2
Peptide H-DAEFRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFEMLILGR-OH
Peptide H-SFEMLILGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLDKGTYTL-OH
H-FLDKGTYTL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EQQCVIMAENR-OH
Peptide H-EQQCVIMAENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GMNEALEK-OH
Peptide H-GMNEALEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALGSTAPPV-OH
Peptide H-ALGSTAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVTDLTK-OH
Peptide H-LVTDLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGSEAYNQQLSEK-OH
Peptide H-IGSEAYNQQLSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQVLLGAHSLSQPEPSK-OH
Peptide H-VQVLLGAHSLSQPEPSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFPIYDFLPAKKK-OH
H-EFPIYDFLPAKKK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-YPRNPTEQGNI-OH
Peptide H-YPRNPTEQGNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RFDNPVLPF-OH
Peptide H-RFDNPVLPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NKKCDKKCIEWEKAQHGA-OH
Peptide H-NKKCDKKCIEWEKAQHGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELFADKVPKTAENFR-OH
Peptide H-ELFADKVPKTAENFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TANDLNLLILR-OH
Peptide H-TANDLNLLILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAKLNREEI-OH
Peptide H-EAKLNREEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDPGLIGPK-OH
Peptide H-GDPGLIGPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AEIRASANL-OH
Peptide H-AEIRASANL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESDPIVAQY-OH
Peptide H-ESDPIVAQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RFIAQLLLL-OH
Peptide H-RFIAQLLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APGLTQALNTK-OH
Peptide H-APGLTQALNTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPGLLGASVLGLDDI-OH
Peptide H-RPGLLGASVLGLDDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGPGVNYSGCQITWAK-OH
Peptide H-LLGPGVNYSGCQITWAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNALQYLR-OH
Peptide H-FNALQYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQVLVFLGQSEGLR-OH
Peptide H-GQVLVFLGQSEGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIPVESIEEVSK-OH
Peptide H-EIPVESIEEVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRGDKGPDC-OH
CAS:Peptide H-CRGDKGPDC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C35H57N13O14S2Molecular weight:948.04 g/molH-SYAAAQRKL-OH
Peptide H-SYAAAQRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EVHHQKLV-NH2
Peptide H-EVHHQKLV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLAVYQAGAR-OH
Peptide H-RLAVYQAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTTLGMALY-OH
Peptide H-VTTLGMALY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATDALMTGY-OH
Peptide H-ATDALMTGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVFTLTVPS-OH
Peptide H-FVFTLTVPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTVL-OH
Peptide H-LTVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YNLRRGTAL-OH
Peptide H-YNLRRGTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKTDHGAEIVYKSPVVSGDTSPR-OH
Peptide H-AKTDHGAEIVYKSPVVSGDTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALGK-OH
H-GGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALGK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C162H284N48O42Molecular weight:3,576.33 g/molH-RHGGWTTKM-OH
Peptide H-RHGGWTTKM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLVALGLNAV-OH
Peptide H-KLVALGLNAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNPESSFNDENLR-OH
Peptide H-GNPESSFNDENLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HVNPVQALSEFK-OH
Peptide H-HVNPVQALSEFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAPEEHPVLLTEAPLNPK-OH
Peptide H-VAPEEHPVLLTEAPLNPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH
H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C229H352N60O47S2Molecular weight:4,761.81 g/mol
