Peptides
Subcategories of "Peptides"
Found 29634 products of "Peptides"
[Tyr1]-Somatostatin
CAS:This product contains disulfide bonds between Cys3-Cys14 can is suitable for use in radioimmunoassays. Somatostatin is a peptide hormone that is produced by the hypothalamus and inhibits the release of growth hormones, insulin, and glucagon. It is widely expressed throughout the body for example in the gastrointestinal (GI) tract, hypothalamus, pancreas and the central nervous system. In the central nervous system somatostatin plays a role in neurotransmission modification and it has also demonstrated to be effective against a number of cancers such as squamous carcinoma.
Formula:C82H108N18O20S2Purity:Min. 95%Molecular weight:1,730 g/molH-IIGGSDADIK-OH
Peptide H-IIGGSDADIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPRPPGGGC-OH
Peptide H-GPRPPGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GGT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GGT2 antibody, catalog no. 70R-8808Purity:Min. 95%Amino-dPEG® Acid
CAS:Amino-dPEG® Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG® Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Purity:Min. 95%Molecular weight:441.51 g/molH-EANQSTLENFLER-OH
Peptide H-EANQSTLENFLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-dPEG®23-NH2
CAS:Biotin-dPEG®23-NH2 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®23-NH2 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C58H114N4O25SPurity:Min. 95%Molecular weight:1,299.6 g/molH-LLEVPEGR-OH
Peptide H-LLEVPEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuromedin-U-23
Neuromedin-U-23 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Angiotensin II (Human)
CAS:Angiotensin II (Human) is a peptide that is produced by the renin-angiotensin system. It has been shown to be an effective inhibitor of the cell adhesion molecule CD44, and can also stimulate the proliferation of cells in culture. Angiotensin II (Human) is a ligand for angiotensin receptors, which are found on many different types of cells. The binding of angiotensin II to these receptors stimulates the production of cyclic AMP, which causes vasoconstriction and increased blood pressure.Formula:C50H71N13O12Purity:Min. 95%Molecular weight:1,046.2 g/molH-LAQEAGNFERISGDL-OH
Peptide H-LAQEAGNFERISGDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
m-dPEG®15-OH
CAS:m-dPEG®15-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, m-dPEG®15-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C31H64O16Purity:Min. 95%Molecular weight:692.83 g/molGRF (Human)
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion. See also GRF (1-29); sermorelin, a shorter fragment. Sequence alignments: porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C215H358N72O66SPurity:Min. 95%Molecular weight:5,039.7 g/molt-boc-N-Amido-dPEG®8-Acid
CAS:t-boc-N-Amido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C34H64N6O13SPurity:Min. 95%Molecular weight:796.97 g/molBis-MAL-Lysine-dPEG®4-Acid
CAS:Bis-MAL-Lysine-dPEG®4-Acid is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.Formula:C20H28N2O12Purity:Min. 95%Molecular weight:488.44 g/molCl-Ac-(OH)Leu-Ala-Gly-NH₂
CAS:Cl-Ac-(OH)Leu-Ala-Gly-NH₂ is a peptide with a molecular weight of 736.2 Da. It is an inhibitor of the enzyme protein kinase C (PKC). Cl-Ac-(OH)Leu-Ala-Gly-NH₂ has been shown to activate PKC by binding to specific domains in the enzyme, which leads to the phosphorylation and activation of PKC's regulatory subunits. This peptide can be used as a research tool in studies involving PKC and also as an antibody carrier for Western blotting and immunohistochemistry.
Formula:C13H23N4O5ClPurity:Min. 95%Molecular weight:350.8 g/mol2-NBDLG
CAS:2-NBDLG is a potent activator of ion channels, which are membrane proteins that allow the passage of ions across biological membranes. It binds to receptor sites on the cell surface and opens ligand-gated ion channels in the plasma membrane, thereby increasing the permeability of the membrane to sodium ions. 2-NBDLG has been shown to inhibit voltage-gated potassium channels and calcium ion (Ca2+) currents in vitro. This drug also has an affinity for various peptides such as bradykinin and substance P. 2-NBDLG is a high purity product with a CAS number of 174844-42-9.Formula:C12H14N4O8Purity:Min. 95%Molecular weight:342.26 g/molHuman Natriuretic peptides A (NPPA)
Human Natriuretic peptides A (NPPA) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-FELLPTPPL-OH
Peptide H-FELLPTPPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MAL-dPEG®2-Acid
CAS:MAL-dPEG®2-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®2-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C38H63N3O19Purity:Min. 95%Molecular weight:865.92 g/molH-NQEQVSPLERCG-NH2
Peptide H-NQEQVSPLERCG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
THEG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of THEG antibody, catalog no. 70R-9548Purity:Min. 95%H-EPQTTVIHNPDGNK-OH
Peptide H-EPQTTVIHNPDGNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VNTEIHFVTK-OH
Peptide H-VNTEIHFVTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CRF (Human, Rat)
CAS:Corticotropin-Releasing Factor (CRF) (Human, Rat) is a peptide hormone product that is available as a 0.5mg vial and has the potential to be used as a research tool to study the effects of CRF in the body. CRF is a natural hormone that regulates many physiological processes, such as blood pressure, temperature control, and food intake. CRF binds to receptors on cells and triggers a number of cellular responses within the cell. This peptide can be used for pharmacological studies or for antibody production.Formula:C208H344N60O63S2Purity:Min. 95%Molecular weight:4,757.5 g/molH-SAGGE-OH
Peptide H-SAGGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MAL-dPEG®4-TFP Ester
CAS:MAL-dPEG®4-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C42H59N5O11SPurity:Min. 95%Molecular weight:842.01 g/molt-Boc-N-Amido-dPEG®11-Amine
CAS:t-Boc-N-Amido-dPEG®11-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-Boc-N-Amido-dPEG®11-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purity:Min. 95%Molecular weight:644.79 g/molH-YGRKKRPQRRR-OH
Peptide H-YGRKKRPQRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Hepcidin-1 (mouse)
Hepcidin-1 (mouse) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RLMGEGTSSL-OH
Peptide H-RLMGEGTSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Angiotensin Heavy Tryptic Peptide Standard (4nmol)
Angiotensin Heavy Tryptic Peptide Standard f use in protein identification and quantitation studies. Angiotensin is a peptide hormone that causes vasoconstriction and is responsible for an increase in blood pressure. Furthermore angiotensin stimulates aldosterone release.Purity:Min. 95%Fmoc-N-Amido-dPEG®8-Acid
CAS:Fmoc-N-Amido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C34H49NO12Purity:Min. 98 Area-%Molecular weight:663.75 g/molH-EELTVSEFL-OH
Peptide H-EELTVSEFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Diamido-dPEG®11-Diamine
CAS:Diamido-dPEG®11-Diamine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Diamido-dPEG®11-Diamine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C31H49N3O13S2Purity:Min. 95%Molecular weight:735.87 g/molH-TVTAMDVVYALK-OH
H-TVTAMDVVYALK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Sarcotoxin IA
Sarcotoxin IA is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Orexin A Peptide
Orexin A Peptide is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-QGYFVEAQPK-OH
Peptide H-QGYFVEAQPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cacng1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Cacng1 antibody, catalog no. 70R-8063Purity:Min. 95%BTF3L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BTF3L1 antibody, catalog no. 70R-8077Purity:Min. 95%HXB2 gag NO-15
HXB2 gag NO-15 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
SPDP-dPEG®24-NHS Ester
CAS:SPDP-dPEG®24-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®24-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C37H60N4O20Purity:Min. 95%Molecular weight:880.89 g/molBis-dPEG®2-PFP Ester
CAS:Bis-dPEG®2-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®2-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C20H12F10O6Purity:Min. 95%Molecular weight:538.29 g/mol[Val5]-Angiotensin I (Bovine)
CAS:[Val5]-Angiotensin I (Bovine) is a peptide that activates angiotensin receptors. It is used as a research tool in the study of ion channels and protein interactions. The antibody recognizes the C-terminal region of angiotensin I, which can be used to inhibit the activation of these receptors by preventing binding to their ligands.Formula:C61H87N17O14•CH3COOH•5H2OPurity:Min. 95%Molecular weight:1,432.53 g/molHumanin
CAS:Encoded for by mitochondrial DNA, Humanin is an endogenous peptide known to be a ‘rescue factor’ with the ability to abolish neuronal cell death. This characteristic has promoted Humanin as a potential treatment for Alzheimer’s disease. Another function of Humanin is it can inhibit mitochondira-dependent apoptosis through preventing the formation of apoptotic bodies and the release of Cytochrome C. Humanin has been found to be related to aging related cardiovascular disease (ACVDs) due to evidence of Humanin serum levels as age increases. Furthermore Humanin increases the expression of antioxidant defense system proteins and impedes complexes I and III from their activity in the electron transport chain in myocardial cells and mitochondria, therefore decreasing oxidative stress damage caused by H2O2. Humanin further reduces reactive oxygen species production and protects cardiomyocytes and fibroblasts, from oxidative stress. Overall Humanin has a variety of protective functions such as mitochondrial homeostasis and redox systems regulation, anti-aging, prevention of myocardial fibrosis, anti-inflammation, metabolism improvement and autophagy promotion. It has also been found to improve beta-cell survival and thus can be used as a diabetes treatment due to it improving insulin secretion and resistance. This product is available as a 0.5mg vial.Formula:C119H204N34O32S2Purity:Min. 95%Molecular weight:2,687.2 g/molLys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Asn-Sta-Val-Ala-Glu-Phe
CAS:Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Asn-Sta-Val-Ala-Glu-Phe is a peptide that inhibits the interaction between the beta2 adrenergic receptor and its ligand. It is a high purity, nonpeptide inhibitor of the beta2 adrenergic receptor that is useful for research purposes. The antibody to Lys-Thr-Glu-Glu-Ile-Ser-Glu Val Asn Sta Val Ala Glu Phe can be used to identify this peptide in Western blot or ELISA experiments.Formula:C73H118N16O27Purity:Min. 95%Molecular weight:1,651.8 g/molLeucine-Enkephalin (Human, Porcine, Bovine, Rat, Mouse)
CAS:Leucine-Enkephalin is a peptide that is composed of the amino acids leucine and enkephalin. It functions as an endogenous opioid with effects on the brain that include analgesia, sedation, and appetite suppression. Leucine-Enkephalin stimulates κ-opioid receptors in the brain and has been shown to reduce neuronal death caused by energy metabolism deficiency or cerebral ischemia. This peptide also causes autophagy and neurokinin-1 receptor activation, which can lead to significant interactions with physiological effects such as symptoms of anxiety, depression, or addiction.Formula:C28H37N5O7•H2OPurity:Min. 95%Molecular weight:573.64 g/molDelta Sleep-Inducing Peptide [DSIP]
CAS:Delta Sleep-Inducing Peptide (DSIP) is a neuropeptide that induces delta sleep in mammals. Studies have shown that DSIP plasma concentrations and the human circadian rhythm are correlated and that DSIP concentrations are dependent on the initiation of sleep. Interestingly DSIP has the ability to cross the blood-brain barrier and can be absorbed from the gut. This neuropeptide is found in plasma, peripheral organs and neurons and its functions extend beyond inducing sleep. For example it has the ability to affect levels of hormones, neurotransmitters and psychological performance. It has also been found that schizophrenia and depression patients have lower concentrations of DSIP in their cerebrospinal fluid and plasma. Clinically DFSIP has already been used to treat opioid and alcohol withdrawal in reducing symptoms felt by patients.
Formula:C35H48N10O15Purity:Min. 95%Molecular weight:848.82 g/molBiotin-dPEG®11-NH2
CAS:Biotin-dPEG®11-NH2 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-NH2 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C34H66N4O13SPurity:Min. 95%Molecular weight:770.97 g/mol
![[Tyr1]-Somatostatin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPSI-4038-V.webp&w=3840&q=75)
![[Val5]-Angiotensin I (Bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPAN-4069-V.webp&w=3840&q=75)
![Delta Sleep-Inducing Peptide [DSIP]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPDS-4054.webp&w=3840&q=75)
