
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 29613 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
| Brand | Product data | Purity | Price range | Estimated delivery |
|---|---|---|---|---|
MAPT Blocking Peptide REF: 3D-33R-6638 | Min. 95% | 265,00 € | Discontinued product | |
H-SYFPEITHI-OH REF: 3D-PP43553 | - - - | 226,00€ ∼ 473,00€ | Discontinued product | |
(Dap 22)-Stichodactyla helianthus Neurotoxin (ShK) REF: 3D-FD109217 CAS: 220384-25-8 | Min. 95% | 243,00€ ∼ 2.304,00€ | Discontinued product | |
H-QAKWRLQTL-OH REF: 3D-PP42988 | - - - | 226,00€ ∼ 473,00€ | Discontinued product | |
H-RRRRRRRRR-OH REF: 3D-PP48422 | - - - | 226,00€ ∼ 473,00€ | Discontinued product | |
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH REF: 3D-PP40152 | - - - | 668,00€ ∼ 1.626,00€ | Discontinued product | |
Stichodactyla helianthus Neurotoxin (ShK) trifluoroacetate salt REF: 3D-FS108658 CAS: 172450-46-3 | Min. 95% | 342,00€ ∼ 2.775,00€ | Discontinued product | |
FAM80A Blocking Peptide REF: 3D-33R-2255 | Min. 95% | 265,00 € | Discontinued product | |
H-YLEPGPVTV-OH REF: 3D-PP43285 | - - - | 226,00€ ∼ 473,00€ | Discontinued product | |
H-MEVGWYRPPFSRVVHLYRNGK-OH REF: 3D-PP46795 | - - - | 358,00€ ∼ 769,00€ | Discontinued product | |
RETNLB Blocking Peptide REF: 3D-33R-1808 | Min. 95% | 265,00 € | Discontinued product | |
FICD Blocking Peptide REF: 3D-33R-3215 | Min. 95% | 265,00 € | Discontinued product | |
Pa2g4 Blocking Peptide REF: 3D-33R-7021 | Min. 95% | 265,00 € | Discontinued product | |
ENOSF1 Blocking Peptide REF: 3D-33R-6601 | Min. 95% | 265,00 € | Discontinued product | |
ZNF264 Blocking Peptide REF: 3D-33R-8480 | Min. 95% | 265,00 € | Discontinued product | |
HSPA8 Blocking Peptide REF: 3D-33R-6448 | Min. 95% | 265,00 € | Discontinued product | |
LAMP3 Blocking Peptide REF: 3D-33R-10246 | Min. 95% | 265,00 € | Discontinued product | |
PCBD2 Blocking Peptide REF: 3D-33R-8496 | Min. 95% | 265,00 € | Discontinued product | |
DAMGO acetate REF: 3D-FA108700 CAS: 100929-53-1 | Min. 95% | 161,00€ ∼ 340,00€ | Discontinued product | |
RBP4 Human REF: 3D-CYT-535 | Min. 95% | To inquire | Discontinued product | |
Pdz1 domain inhibitor peptide REF: 3D-QCC37873 CAS: 1315378-73-4 | Min. 95% | To inquire | Discontinued product | |
SCAND2 Blocking Peptide REF: 3D-33R-4123 | Min. 95% | 265,00 € | Discontinued product | |
Complement C8b Blocking Peptide REF: 3D-33R-8493 | Min. 95% | 265,00 € | Discontinued product | |
LOC732272 Blocking Peptide REF: 3D-33R-6580 | Min. 95% | 265,00 € | Discontinued product | |
SLC26A10 Blocking Peptide REF: 3D-33R-6367 | Min. 95% | 265,00 € | Discontinued product | |
FBXO32 Blocking Peptide REF: 3D-33R-7699 | Min. 95% | 265,00 € | Discontinued product | |
NIP7 Blocking Peptide REF: 3D-33R-7091 | Min. 95% | 265,00 € | Discontinued product | |
Pannexin 1 Blocking Peptide REF: 3D-33R-5005 | Min. 95% | 265,00 € | Discontinued product | |
PSMA1 Blocking Peptide REF: 3D-33R-6001 | Min. 95% | 265,00 € | Discontinued product | |
H-GGH-OH REF: 3D-PG16889 | - - - | 215,00€ ∼ 449,00€ | Discontinued product | |
SF3B4 Blocking Peptide REF: 3D-33R-8421 | Min. 95% | 265,00 € | Discontinued product | |
H-LSPSFADLFR-OH REF: 3D-PL16891 | - - - | 268,00€ ∼ 627,00€ | Discontinued product | |
H-DNEAYEMP-OH REF: 3D-PD08436 | - - - | 247,00€ ∼ 557,00€ | Discontinued product | |
H-VGEIYKRWIILGLNK-OH REF: 3D-PV17125 | - - - | 322,00€ ∼ 765,00€ | Discontinued product | |
H-VMTPRTLLL-OH REF: 3D-PV17134 | - - - | 258,00€ ∼ 592,00€ | Discontinued product | |
H-NVNDVIAPAFVK-OH REF: 3D-PN16890 | - - - | 290,00€ ∼ 699,00€ | Discontinued product | |
CXORF34 Blocking Peptide REF: 3D-33R-3146 | Min. 95% | 265,00 € | Discontinued product | |
H-AYGRKKRRQRRR-OH REF: 3D-PA00039 | - - - | 290,00€ ∼ 699,00€ | Discontinued product | |
PEP1 REF: 3D-PP16886 | - - - | 462,00€ ∼ 1.407,00€ | Discontinued product | |
PTRH2 Blocking Peptide REF: 3D-33R-8080 | Min. 95% | 265,00 € | Discontinued product | |
Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse) REF: 3D-PM16887 | - - - | 258,00€ ∼ 592,00€ | Discontinued product | |
H-YKQTSV-OH REF: 3D-PY00004 | - - - | 226,00€ ∼ 484,00€ | Discontinued product | |
Elicitor peptide AtPep1 REF: 3D-PE16964 | - - - | 383,00€ ∼ 1.035,00€ | Discontinued product | |
Leptin (57 - 74) REF: 3D-PL16881 | - - - | 354,00€ ∼ 867,00€ | Discontinued product | |
H-SIIPR-OH REF: 3D-PS00026 | - - - | 215,00€ ∼ 449,00€ | Discontinued product | |
CMVpp65 - 9 REF: 3D-PC16871 | - - - | 333,00€ ∼ 798,00€ | Discontinued product | |
H-VMTPRTLVL-OH REF: 3D-PV17135 | - - - | 258,00€ ∼ 592,00€ | Discontinued product | |
H-EHHG-OH REF: 3D-PE16976 | - - - | 215,00€ ∼ 449,00€ | Discontinued product | |
H-LAWHC-OH REF: 3D-PL16895 | - - - | 215,00€ ∼ 449,00€ | Discontinued product | |
H-LPFFSNVTWF-OH REF: 3D-PL16889 | - - - | 268,00€ ∼ 627,00€ | Discontinued product |