Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30318 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Leu-Val
CAS:Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.Formula:C11H22N2O3Purity:99.32%Color and Shape:SolidMolecular weight:230.3Hainantoxin-IV
CAS:Hainantoxin-IV acts as a specific antagonist for tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with His28 and Lys32 being critical residues forFormula:C166H257N53O50S6Purity:98%Color and Shape:SolidMolecular weight:3987.53Aam-KTX
Aam-KTX, a toxic peptide sourced from Mesobuthus eupeus scorpion venom, acts as a selective K_v channel inhibitor, exhibiting IC_50 values of 1.1 nM for K_v1.3Formula:C174H288N58O48S7Purity:98%Color and Shape:SolidMolecular weight:4184.96Hainantoxin-III
CAS:Jingzhaotoxin-V is a peptide that suppresses potassium currents in Xenopus laevis oocytes, exhibiting an IC50 of 604.2 nM, while concurrently targeting bothFormula:C154H228N44O45S6Purity:98%Color and Shape:SolidMolecular weight:3608.12Calciseptin
CAS:Calciseptine, a neurotoxin isolated from the Black Mamba (Dendroaspis p.Formula:C299H468N90O87S10Purity:98%Color and Shape:SolidMolecular weight:7036.12ω-Conotoxin CVIE
<p>ω-Conotoxin CVIE selectively inhibits voltage-gated Ca^2+ channels (Ca_v 2.2) [1].</p>Formula:C98H164N40O34S6Purity:98%Color and Shape:SolidMolecular weight:2638.99N-Acetylcarnosine acetate
N-Acetylcarnosine acetate, a dipeptide, yields L-carnosine and treats human cataracts.Formula:C13H20N4O6Purity:98%Color and Shape:SolidMolecular weight:328.32Tap1a
<p>Theraphotoxin-Tap1a (Tap1a) is a spider venom-derived peptide that acts as an inhibitor of sodium channels, displaying IC50 values of 80 nM for Na v 1.7 and 301</p>Formula:C174H258N52O55S7Purity:98%Color and Shape:SolidMolecular weight:4182.68δ-Theraphotoxin-Hm1b
δ-Theraphotoxin-Hm1b, a 42-amino acid peptide derived from the Togo starburst tarantula (Heteroscodra maculata) venom, selectively inhibits the inactivation ofFormula:C169H241N45O50S6Purity:98%Color and Shape:SolidMolecular weight:3895.38Agavoside H
CAS:<p>Agavoside H is a biochemical.</p>Formula:C68H112O37Purity:98%Color and Shape:SolidMolecular weight:1521.607Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purity:98%Color and Shape:SolidMolecular weight:3692.15LSKL TFA
CAS:LSKL TFA (H-Leu-Ser-Lys-Leu-NH2 TFA) is a TGF-尾1 antagonist that inhibits TSP-1 binding to LAP and reduces renal interstitial fibrosis and liver fibrosis.Formula:C23H43F3N6O7Purity:99.33%Color and Shape:SolidMolecular weight:572.62Prepro VIP (111-122), human
CAS:Prepro VIP (111-122), human is a prepro-vasoactive intestinal polypeptide (VIP)–derived peptide, corresponding to residues 111-122.Formula:C53H87N13O21Purity:98%Color and Shape:SolidMolecular weight:1242.33Neuropeptide Y (scrambled) Acetate
<p>Neuropeptide Y (scrambled) Acetate (Pro-Neuropeptide Y (scrambled) Acetate) is a scrambled peptide of Neuropeptide Y that has been implicated in Alzheimer's</p>Formula:C190H287N55O57Purity:99.07% - 99.57%Color and Shape:SolidMolecular weight:4251.12Biotin-myelin basic protein (94-102)
CAS:<p>Biotin-myelin basic protein (94-102) is a peptide fragment crucial for myelin adhesion within the nervous system, facilitating myelination.</p>Formula:C49H84N20O13SColor and Shape:SolidMolecular weight:1193.38Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Formula:C26H51N3O5Purity:98%Color and Shape:SolidMolecular weight:485.7FITC-β-Ala-β-Amyloid (25-35)
<p>FITC-β-Ala-β-Amyloid (25-35) is a FITC-labeled fluorescent compound utilized in Alzheimer's disease research [1].</p>Color and Shape:Odour SolidCGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formula:C162H262N50O52S2Purity:98%Color and Shape:SolidMolecular weight:3806.35-CR110 [5-Carboxyrhodamine 110] *Single isomer*
CR110 reagents are more photostable and pH-independent than FITC/FAM, with optimal absorption at 488 nm.Formula:C21H15N2O5ClPurity:98%Color and Shape:SolidMolecular weight:410.81Adrenomedullin (AM) (1-52), human
CAS:Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.Formula:C264H406N80O77S3Purity:98%Color and Shape:SolidMolecular weight:6028.82Ac-GpYLPQTV-NH2 acetate
Ac-GpYLPQTV-NH2 acetate is a STAT3 inhibitor with an IC50 value of 0.33 μM. It also exhibits antitumor properties.Formula:C38H60N9O14P·xC2H4O2Color and Shape:SolidMolecular weight:897.91 (free base)Proadrenomedullin (45-92), human
CAS:Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM.Formula:C215H359N67O73S2Purity:98%Color and Shape:SolidMolecular weight:5114.76Arthrofactin
CAS:Arthrofactin is a lipopeptide biosurfactant.Formula:C64H111N11O20Purity:98%Color and Shape:SolidMolecular weight:1354.649MAPI
CAS:<p>MAPI is an irreversible peptidyl 3C cysteine protease (SV3CP) inhibitor. By covalently attaching its C-terminal Michael acceptor moiety to the active site thiol of SV3CP Cys 139, MAPI inhibits SV3CP. It shows potential for use in the study of norovirus infections.</p>Formula:C36H53N7O11Color and Shape:SolidMolecular weight:759.85NFAT Inhibitor acetate
NFAT Inhibitor acetate (VIVIT peptide acetate) is a NFAT peptide inhibitor of calmodulin phosphatase-mediated NFAT dephosphorylation.Formula:C77H122N20O24SPurity:99.66%Color and Shape:SolidMolecular weight:1743.98FLDKFNHEAEDLFYQSSL
FLDKFNHEAEDLFYQSSL is an 18-residue peptide that binds to the SARS-CoV-2 receptor-binding domain (RBD). It inhibits the entry of SARS-CoV-2 and also interacts with binding residues (Leu455, Phe456, Ala475, and Gln493).Formula:C102H143N23O32Color and Shape:SolidMolecular weight:2203.36Arg-Ala-Asp-Cys acetate
Arg-Ala-Asp-Cys acetate is a tetrapeptide compound.Formula:C18H33N7O9SPurity:95.32%Color and Shape:SolidMolecular weight:523.56Cerebellin
CAS:Cerebellin: 16-amino acid peptide, from rat cerebellum, now found in human adrenal glands, mainly medullary chromaffin cells.Formula:C69H113N23O23Purity:98%Color and Shape:SolidMolecular weight:1632.78SIYRY
CAS:SIYRY is a Kb-restricted epitope peptide.Formula:C50H71N11O13Purity:98%Color and Shape:SolidMolecular weight:1034.16NY-BR-1 p904 (A2)
CAS:T-cell clones specific for this NY-BR-1 epitope (p904) can recognize breast tumor cells expressing NY-BR-1.Formula:C43H78N10O15Purity:98%Color and Shape:SolidMolecular weight:975.14SV40 T-Ag-derived NLS peptide
CAS:This peptide, a nuclear localization signal DNA tagged to this peptide efficiently translocates into the cell nucleus.Formula:C66H111N19O18SPurity:98%Color and Shape:SolidMolecular weight:1490.77α-Conotoxin GI acetate
α-Conotoxin GI acetate is a competitive antagonist of the muscle-type nicotinic acetylcholine receptors (nAChR).Formula:C57H84N20O20S4Purity:96.49%Color and Shape:SolidMolecular weight:1497.66Rink Amide MBHA resin (100 - 200 mesh); loading 0.54 mmol/g
CAS:Color and Shape:White to light-yellow or beige beadsMolecular weight:-Nifalatide
CAS:<p>Nifalatide is a analog of enkephalin.</p>Formula:C30H39N7O9SPurity:98%Color and Shape:SolidMolecular weight:673.74RETF-4NA acetate
RETF-4NA acetate is a sensitive, specific substrate for chymotrypsin.Formula:C34H47N9O12Purity:97.6400%Color and Shape:SolidMolecular weight:773.79Bam 12P acetate
Bam 12P acetate is the putative enkephalin precursor in bovine adrenal, pituitary, and hypothalamus.Formula:C64H101N21O18SPurity:98.84%Color and Shape:SolidMolecular weight:1484.68PKC ζ pseudosubstrate
Inhibitor of protein kinase C (PKC) ζ; attached to cell permeabilisation Antennapedia domain vector peptide.Formula:C208H336N74O44S3Purity:98%Color and Shape:SolidMolecular weight:4673.59TAK-683 TFA (872719-49-8 free base)
TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.Formula:C66H84F3N17O15Purity:98%Color and Shape:SolidMolecular weight:1412.47Laminin (925-933)(TFA) (110590-60-8 free base)
Laminin (925-933) (TFA) is a peptide derived from residues 925-933 of the Laminin B1 chain that binds to the laminin receptor.Formula:C42H63F3N12O16SPurity:98%Color and Shape:SolidMolecular weight:1081.08eukaryotic translation initiation factor 3
<p>Eukaryotic initiation factors (eIF) are proteins involved in the initiation phase of eukaryotic translation.</p>Formula:C47H84N14O14SPurity:98%Color and Shape:SolidMolecular weight:1101.32SVS-1 peptide
CAS:SVS-1 peptide is an anticancer peptide that selectively targets cancer cells through electrostatic interactions, disrupting the cell membrane structure and inducing cell death. Unlike antimicrobial peptides, the activity of SVS-1 peptide occurs before the complete neutralization of membrane charges.Formula:C97H183N27O19Color and Shape:SolidMolecular weight:2031.66PACE4 Inhibitory peptide C23
CAS:<p>PACE4 Inhibitory peptide C23 (Compound C23) is an effective peptidomimetic inhibitor known to act against PACE4. It exhibits antiproliferative effects on PCa cell lines, with a Ki of 5 nM, and IC50 values of 25 μM and 40 μM for DU145 and LNCaP cells, respectively. Additionally, PACE4 Inhibitory peptide C23 suppresses tumor growth in LNCaP xenograft mice.</p>Formula:C51H90N14O8Color and Shape:SolidMolecular weight:1027.35Phytochelatin 4
CAS:<p>Phytochelatin 4 (PC 4) a heavy metal detoxifier/chelator consisting of 4 units of glu - cys , tolerant to Cd (cadmium), ultimately sequestered in the vesicle.</p>Formula:C34H53N9O18S4Purity:95.98%Color and Shape:SolidMolecular weight:1004.09Peptide C105Y
CAS:C105Y, a synthetic peptide mimicking alpha1-antitrypsin residues 359-374, boosts DNA nanoparticle gene expression.Formula:C97H148N20O23SPurity:98%Color and Shape:SolidMolecular weight:1994.4Ac-LETD-AFC
CAS:Ac-LETD-AFC is a fluorescent substrate that can be specifically cleaved by caspase-8. λEx(nm) of Ac-LETD-AFC is 400 nm and λEm is 505 nm.Formula:C31H38F3N5O12Purity:99.67%Color and Shape:SolidMolecular weight:729.65N-Oleoyl Glutamine
CAS:<p>N-Oleoyl Glutamine (Oleoyl-L-glutamine) antagonizes TRPV1 of the transient receptor potential (TRP) calcium channel.</p>Formula:C23H42N2O4Purity:99.61%Color and Shape:SolidMolecular weight:410.59α-Gliadin (43-49)
CAS:alpha-Gliadin (43-49) is a Gliadian sequence peptide. It could induce leukocyte migration inhibition but be blocked by naloxone.Formula:C43H57N9O11Purity:98%Color and Shape:SolidMolecular weight:875.97Bis(tetramethylene)fluoroformamidinium hexafluorophosphate
CAS:Formula:C9H16F7N2PMolecular weight:316.20Ac-FEID-CMK TFA
Ac-FEID-CMK TFA is a zebrafish GSDMEb-derived peptide inhibitor that acts by inhibiting the caspy2-mediated atypical inflammatory vesicle pathway.Formula:C29H38ClF3N4O11Purity:95%Color and Shape:SolidMolecular weight:711.08
