Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30315 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PR 39 (porcine) acetate
PR 39 (porcine) acetate is a noncompetitive, reversible and allosteric proteasome inhibitor.Purity:98%Color and Shape:LiquidMolecular weight:N/ACompetence-Stimulating Peptide-12261
CAS:Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.Formula:C100H149N31O23Purity:98%Color and Shape:SolidMolecular weight:2153.45WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Formula:C55H74N10O13SPurity:98%Color and Shape:SolidMolecular weight:1115.3CLIP (86-100) (TFA) (648881-58-7 free base)
CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.Formula:C74H129F3N20O21S3Purity:98%Color and Shape:SolidMolecular weight:1788.13immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.Formula:C54H83N13O13Purity:98%Color and Shape:SolidMolecular weight:1122.32OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFormula:C63H100N20O22Purity:98%Color and Shape:SolidMolecular weight:1489.59Tyroserleutide TFA (138168-48-6 free base)
Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.Formula:C20H28F3N3O8Purity:98%Color and Shape:SolidMolecular weight:495.45parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis]
Parathyroid hormone (7-34) peptide, sequence H2N-LMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW=3474.03, increases blood Ca2+ via PTH1 & PTH2 receptors.Formula:C154H246N48O40S2Purity:98%Color and Shape:SolidMolecular weight:3474.03Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Formula:C26H51N3O5Purity:98%Color and Shape:SolidMolecular weight:485.7Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purity:98%Color and Shape:SolidMolecular weight:3692.15mTRP-2 (180-188)
CAS:<p>This peptide is a TRP-tyrosinase-related protein. Its immunization results in effective induction of antitumor immunity.</p>Formula:C61H78N10O14Purity:98%Color and Shape:SolidMolecular weight:1175.33Velmupressin
CAS:<p>Peptidic V2R agonist, c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2, with EC50: 0.07 nM (hV2R), 0.02 nM (rV2R); selective, short-acting.</p>Formula:C42H60ClN11O8S2Purity:98%Color and Shape:SolidMolecular weight:946.58β-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Formula:C49H76N12O15Purity:98%Color and Shape:SolidMolecular weight:1073.2BNP-45 (rat) (TFA) (123337-89-3 free base)
BNP-45 (rat) TFA is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.Formula:C215H350N71O67F3S3Purity:98%Color and Shape:SolidMolecular weight:5154.69[pThr3]-CDK5 Substrate (TFA)
[pThr3]-CDK5 Substrate TFA is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM.Formula:C55H101F3N15O17PPurity:98%Color and Shape:SolidMolecular weight:1332.45PUMA BH3 (TFA)
PUMA BH3 (TFA) is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.Formula:C130H203F3N42O45SPurity:98%Color and Shape:SolidMolecular weight:3163.32Prion Protein 106-126 (human)
CAS:Prion peptide fragment that exhibits neurotoxicityFormula:C80H138N26O24S2Purity:98%Color and Shape:SolidMolecular weight:1912.24RO27-3225 TFA (274682-89-2 free base)
RO27-3225 TFA: potent MC4R agonist (EC50: 1 nM), 30x more selective than MC3R, neuroprotective, anti-inflammatory.Formula:C41H53F3N12O8Purity:98%Color and Shape:SolidMolecular weight:898.93type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Formula:C47H77N13O15Purity:98%Color and Shape:SolidMolecular weight:1064.19Peptide VF13N
CAS:<p>Peptide VF13N is a synthetic rabies virus glycoprotein T helper cell epitope.</p>Formula:C57H88N14O23SPurity:98%Color and Shape:SolidMolecular weight:1369.45Sdrnflrfamide
CAS:Sdrnflrfamide exhibits FMRFamide-like immunoreactivity isolated from the nervous system of the lobster Homarus americanus.Formula:C47H72N16O12Purity:98%Color and Shape:SolidMolecular weight:1053.17Asp-Asp-Asp-Asp-Asp
CAS:Asp-Asp-Asp-Asp-Asp is a peptide consists of 5 Asp.Formula:C20H27N5O16Purity:98%Color and Shape:SolidMolecular weight:593.45NP213 TFA (942577-31-3 free base)
NP213 TFA: first synthetic AMP with fast-acting anti-fungal action, disrupts fungal membranes.Formula:C44H85F3N28O9Purity:98%Color and Shape:SolidMolecular weight:1207.32Cholecystokinin pentapeptide
CAS:Cholecystokinin pentapeptide is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein.Formula:C31H39N7O7SPurity:98%Color and Shape:SolidMolecular weight:653.75Syntide 2 (TFA) (108334-68-5 free base)
Syntide 2 (TFA), a CaMKII substrate, inhibits GA response without affecting silicoic acid regulation.Formula:C70H123N20F3O20Purity:98%Color and Shape:SolidMolecular weight:1621.84Antennapedia Peptide FAM-labeled
Antennapedia Peptide FAM-labeled, a fluorophore-tagged peptide, functions as a molecular probe in cancer research [1].Color and Shape:Odour SolidEthyl (hydroxyimino)cyanoacetate
CAS:Formula:C5H6N2O3Purity:≥ 98.0%Color and Shape:White to pale yellow crystals or crystalline powderMolecular weight:142.11Eptifibatide
CAS:Eptifibatide is an antiplatelet, a cyclic heptapeptide made of 6 amino acids and a mercaptopropionyl.Formula:C35H49N11O9S2Purity:98%Color and Shape:White PowderMolecular weight:831.96Phytochelatin 3
CAS:Phytochelatin 3 (PC3) is a glutathione-derived peptide and heavy metal detoxifier/chelator consisting of 3 units of glu-cys.Formula:C26H41N7O14S3Color and Shape:SolidMolecular weight:771.84H-Lys-Trp-Lys-OH acetate
<p>H-Lys-Trp-Lys-OH acetate is a peptide with antibacterial and antiviral activities.</p>Formula:C25H40N6O6Purity:99.50%Color and Shape:SolidMolecular weight:520.62Biotin-Gastrin Releasing Peptide, human
<p>Biotin-Gastrin Releasing Peptide, human, is a biotinylated derivative of gastrin-releasing peptide (GRP), a neuropeptide known for its growth-stimulatory and</p>Color and Shape:Odour SolidBiotin-Crosstide TFA
Biotin-crosstide is a derivative of the peptide Akt substrate crosstide, featuring biotinylation.Formula:C58H91N19O19S·XCF3COOHColor and Shape:SolidMolecular weight:1390.53NBD peptide
CAS:NBD peptide inhibits the NF-κB signaling pathway by preventing the binding of the NEMO-IKK complex. It exhibits anti-inflammatory activity by blocking the production of pro-inflammatory cytokines. Additionally, NBD peptide demonstrates immunosuppressive effects through the regulation of immune cells. It enhances transmembrane capacity by conjugating with the cell-penetrating peptide HIV-TAT.Formula:C62H88N14O20Color and Shape:SolidMolecular weight:1349.44Cucumechinoside D
CAS:Cucumechinoside D is a natural bioactive chemical.Formula:C54H84O32S3Purity:98%Color and Shape:SolidMolecular weight:1341.41HEX3
CAS:HEX3 is a truncated form of the adenoviral hexon, which serves as the primary capsid protein for adenovirions.Formula:C47H78N12O14Purity:98%Color and Shape:SolidMolecular weight:454.06Adrenomedullin (AM) (1-52), human
CAS:Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.Formula:C264H406N80O77S3Purity:98%Color and Shape:SolidMolecular weight:6028.82Somatostatin-28 (1-12)
CAS:Somatostatin-28 (1-12) is a somatostatin fragment which is monitored in brain tissue to track processing of somatostatin.Formula:C49H81N17O19SPurity:98%Color and Shape:SolidMolecular weight:1244.33BDC2.5 mimotope 1040-51
CAS:BDC2.5 mimotope 1040-51 is an agonistic peptide for T cells in diabetic NOD mice.Formula:C60H99N17O13SPurity:98%Color and Shape:SolidMolecular weight:1298.6Proadrenomedullin (45-92), human
CAS:Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM.Formula:C215H359N67O73S2Purity:98%Color and Shape:SolidMolecular weight:5114.76Small cardioactive peptide A
CAS:Small cardioactive peptide A modulates neuromuscular connections and feeding behavior in molluscs as a cotransmitter.Formula:C59H92N18O12SPurity:98%Color and Shape:SolidMolecular weight:1277.54HBTU
CAS:Formula:C11H16F6N5OPPurity:≥ 99.0%Color and Shape:White to almost white powder or crystalsMolecular weight:379.25CGGRGD TFA (1260223-44-6 free base)
CGGRGD TFA synthesized via solid-phase synthesis; PCL fibers aminolysed with amino 2-cyanobenzothiazole, then CBT added.Formula:C21H34F3N9O11SPurity:98%Color and Shape:SolidMolecular weight:677.61Microcystin YR
CAS:Microcystin YR (Cyanoginosin YR) is a cyclic peptide and acts as an inhibitor of protein phosphatase 2A (PP2A).Formula:C52H72N10O13Color and Shape:SolidMolecular weight:1045.19MAPI
CAS:MAPI is an irreversible peptidyl 3C cysteine protease (SV3CP) inhibitor. By covalently attaching its C-terminal Michael acceptor moiety to the active site thiol of SV3CP Cys 139, MAPI inhibits SV3CP. It shows potential for use in the study of norovirus infections.Formula:C36H53N7O11Color and Shape:SolidMolecular weight:759.85S-palm P0(180-199) TFA
S-palm P0(180–199) (TFA) is a peptide that enhances MHC II-restricted responses. It is utilized to develop models of chronic inflammatory demyelinating polyradiculoneuropathy (CIDP) and chronic experimental autoimmune neuritis (c-EAN). S-palm P0(180–199) (TFA) is also studied in the context of autoimmune-mediated neuritis.Formula:C112H191N33O29S2·xC2HF3O2Color and Shape:SolidMolecular weight:2528.05 (free base)Extracellular Death Factor TFA
Extracellular death factor TFA (EDF TFA) is a linear pentapeptide that communicating cells produce and release, which activates the cell death pathway.Purity:98.77%Color and Shape:Odour SolidPIC1 PA
CAS:PIC1 PA, a peptide consisting of 15 amino acids, serves as an effective analog of PIC1 that inhibits complement activation mediated by the classical pathway. Functionally, PIC1 PA interferes with the interaction between the C1s-C1r-C1r-C1s/MASPs and the collagen-like region (CLR) of C1q/MBL. It specifically binds to the CLR of C1q, with an average equilibrium dissociation constant (KD) of 33.3 nM when binding purified C1q.Formula:C71H123N19O21S2Color and Shape:SolidMolecular weight:1642.98Lqvtdsglyrcviyhpp TFA
Lqvtdsglyrcviyhpp TFA is a TREM-1 inhibitor with potential anticancer activity and can be used to study skin and pancreatic cancer.Formula:C91H138F3N23O27SPurity:95%Color and Shape:SolidMolecular weight:2075.27Suc-AEPF-AMC
CAS:<p>Suc-AEPF-AMC (Suc-Ala-Glu-Pro-Phe-AMC) is a peptide substrate for the peptidyl prolyl isomerases Pin1 and Par14, and is a peptide compound that can be used to assay protease activity.</p>Formula:C36H41N5O11Purity:99.14%Color and Shape:SoildMolecular weight:719.74MARK Substrate
CAS:MARK Substrate is a MARK substrate peptide.Formula:C60H108N18O21Purity:98%Color and Shape:SolidMolecular weight:1417.61
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
