
Peptides
Subcategories of "Peptides"
Found 29926 products of "Peptides"
H-NWVYSHDGVSLHELLAAELTK^^-OH
Peptide H-NWVYSHDGVSLHELLAAELTK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Leu-Pro-Phe-Phe-Asp-NH2
CAS:Ac-Leu-Pro-Phe-Phe-Asp-NH2 is a potential therapeutic for Alzheimer's disease. It has been shown to reduce the production of reactive oxygen species and inhibit the formation of amyloid beta oligomers. Ac-Leu-Pro-Phe-Phe-Asp-NH2 also reduces the frequency of protofibrils, which are aggregates that may play a role in Alzheimer's disease pathology. This peptide has been shown to have a protective effect on cell populations, which may lead to therapeutics that can delay or prevent Alzheimer's disease. Ac-Leu-Pro-Phe-Phe-Asp NH2 is an inhibitor of amyloid beta peptides and modulates their aggregation into protofibrils.
Formula:C35H46N6O8Purity:Min. 95%Molecular weight:678.89 g/molLCBiot-MGSSHHHHHHSSGLVPRGSH-OH
Peptide LCBiot-MGSSHHHHHHSSGLVPRGSH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIDYFQPNNK^-OH
Peptide H-TIDYFQPNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPLTNA^IK^-OH
Peptide H-FPLTNA^IK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VGAVPG-NH2
Peptide Ac-VGAVPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-K^LVVVGADGV-OH
Peptide H-K^LVVVGADGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EEMQRR^-NH2
Peptide H-EEMQRR^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLDTSSLTQSAPASPTNK^-OH
Peptide H-VLDTSSLTQSAPASPTNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CERFLGTSEATKL-OH
Peptide Ac-CERFLGTSEATKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALAEHGIVFGEPK^-OH
Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSGLLDLALGK^-OH
Peptide H-LSGLLDLALGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VNSAAFPAPIEK^-OH
Peptide H-VNSAAFPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH
H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C200H377N125O51Molecular weight:5,349 g/molH-CSIHRILQRMCERAEGTVGV-NH2
Peptide H-CSIHRILQRMCERAEGTVGV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTVSGTL^^IGLEFIR-OH
Peptide H-GTVSGTL^^IGLEFIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DISEMFLQIYK^-OH
Peptide H-DISEMFLQIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-PPPPPP
Peptide Biot-PPPPPP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza NP (147-155)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C48H82N16O14Molecular weight:1,107.29 g/molH-ALDLLDR^-OH
Peptide H-ALDLLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SYL^DSGIHF-OH
Peptide H-SYL^DSGIHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSIQ^D^WV^Q^K^-OH
Peptide H-VTSIQ^D^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLQEAAEER^-OH
Peptide H-GLQEAAEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEWLR^-OH
Peptide H-VEWLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELVEPLTPSGEAPNQALLR^-OH
Peptide H-ELVEPLTPSGEAPNQALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-VPFA
Peptide Fmoc-VPFA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SALVNEYNVDASR^-OH
Peptide H-SALVNEYNVDASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^T^SGSTSTSR^-OH
Peptide H-V^T^SGSTSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HPDYSVVLLLR^-OH
Peptide H-HPDYSVVLLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADVTPADFSEWSK^-OH
Peptide H-ADVTPADFSEWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Proinsulin C-peptide (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C129H211N35O48Molecular weight:3,020.26 g/molH-SDVVYTDWK^-OH
Peptide H-SDVVYTDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADGGAEYATYQTK^-OH
Peptide H-ADGGAEYATYQTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQNILTEEPK^-OH
Peptide H-IQNILTEEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.DOTA-CPRECESIC-OH
Peptide DOTA-CPRECESIC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-Cys(4-CH3Bzl)-OH
CAS:Boc-Cys(4-CH3Bzl)-OH is a building block for the synthesis of peptides and other biologically active molecules. It is a protected amino acid that can be used in peptide synthesis, and it is commonly used as a building block for the synthesis of Boc-protected L-amino acids.
Formula:C16H23NO4SPurity:Min. 95%Molecular weight:325.42 g/molAc-CKAALDEQFEPRKTL-NH2
Peptide Ac-CKAALDEQFEPRKTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FGQGSGPIVLDDVR^-OH
Peptide H-FGQGSGPIVLDDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C194H295N55O57Molecular weight:4,309.81 g/molH-SFGNPFEPQAR^-OH
Peptide H-SFGNPFEPQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLQVNSL^QTV-OH
Peptide H-DLQVNSL^QTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SADTNKRKRDEGIQESPVC-NH2
Peptide Ac-SADTNKRKRDEGIQESPVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SKEIQPRSLKIRAC-NH2
Peptide Ac-SKEIQPRSLKIRAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTGILDSLGR^-OH
Peptide H-DTGILDSLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Trp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C68H100N18O21Molecular weight:1,505.63 g/molH-ARTKQTARKSTGGKAPRKQLA-NTPEGBiot
Peptide H-ARTKQTARKSTGGKAPRKQLA-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H5N1 Labeled 5-peptide Mixture
Pack contains 100 vials. Peptide sequences:
H5N1 labeled seq1 H-IQIIPK^-OH H5N1 labeled seq2 H-LVLATGLR^-OHH5N1 labeled seq3 H-EFNNLER^-OH H5N1 labeled seq4 H-TLDFHDSNVK^-OHH5N1 labeled seq5 H-EEISGVK^-OH R^ = Arginine (U-13C6,15N4)K^ = Lysine (U-13C6,15N2)1nmol/peptide/vial and provided as dry aliquotsPurity:Min 98%H-VVSVLTVLHQDWLNGKEY^K-OH
Peptide H-VVSVLTVLHQDWLNGKEY^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pHLIP WT
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:4,525.87 g/molMarfey's reagent
CAS:Marfey's reagent is a mixture of l-tartaric acid, hydrochloric acid and trifluoroacetic acid. It is used to determine the presence of β-amino acids in urine samples by reacting with the amide group on the β-amino acid. The reaction produces a white precipitate that can be filtered and analyzed using a UV spectrophotometer or LC/MS/MS. Marfey's reagent has significant cytotoxicity and should not be used in cell culture experiments.Formula:C9H9FN4O5Purity:Min. 95%Molecular weight:272.19 g/mol
