GPCR/G-Protéine
Les inhibiteurs des GPCR/protéines G sont des composés qui ciblent les récepteurs couplés aux protéines G (GPCR) et les protéines G associées, qui jouent un rôle crucial dans la transmission des signaux de l'extérieur vers l'intérieur des cellules. Ces inhibiteurs sont essentiels pour étudier les voies de signalisation médiées par les GPCR, impliquées dans de nombreux processus physiologiques, y compris la perception sensorielle, la réponse immunitaire et la neurotransmission. Les inhibiteurs des GPCR sont également importants dans le développement de médicaments, car de nombreux agents thérapeutiques ciblent ces récepteurs. Chez CymitQuimica, nous offrons une large gamme d'inhibiteurs de GPCR/protéines G de haute qualité pour soutenir vos recherches en pharmacologie, biologie cellulaire et domaines connexes.
Sous-catégories appartenant à la catégorie "GPCR/G-Protéine"
- récepteur 5-HT(1.025 produits)
- Récepteur d'adénosine(249 produits)
- Récepteur adrénergique(3.030 produits)
- Récepteur de la bombésine(35 produits)
- Récepteur de la bradykinine(61 produits)
- CXCR(159 produits)
- CaSR(34 produits)
- Récepteur cannabinoïde(217 produits)
- Cholécystokinine(1 produits)
- Récepteur de la dopamine(445 produits)
- Récepteur de l'endothéline(86 produits)
- Récepteur GNRH(84 produits)
- GPCR19(33 produits)
- GRK(33 produits)
- GTPase(22 produits)
- Récepteur du glucagon(196 produits)
- Hérisson/Smoothened(49 produits)
- Récepteur de l'histamine(385 produits)
- Récepteur LPA(21 produits)
- Récepteur de la mélatonine(26 produits)
- Récepteur OX(42 produits)
- Récepteur opioïde(325 produits)
- PAFR(14 produits)
- PKA(55 produits)
- Récepteur S1P(17 produits)
- SGLT(31 produits)
- Récepteur Sigma(46 produits)
Affichez 19 plus de sous-catégories
5985 produits trouvés pour "GPCR/G-Protéine"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cannabigerorcinic Acid
CAS :Cannabigerorcinic acid, structurally akin to recognized phytocannabinoids, serves as an analytical reference standard designed for research and forensic purposes.Formule :C18H24O4Couleur et forme :SolidMasse moléculaire :304.386HAEGTFTSD
CAS :HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.Formule :C40H57N11O17Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :963.94Ala5-Galanin (2-11)
CAS :Ala5-Galanin (2-11) is a specific agonist for the galanin receptor 2 (GAL2R) with an affinity constant (Ki) of 258 nM [1].Formule :C54H81N13O13Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1120.36α-Prostaglandin I1
CAS :6α-Prostaglandin I1 (6α-PGI1) is a stable Prostaglandin I2 (PGI2) analog resistant to hydrolysis in aqueous solutions.Formule :C20H34O5Couleur et forme :SolidMasse moléculaire :354.487Zenagamtide sodium
Zenagamtide is an agonist for both glucagon-like peptide-1 (GLP-1) and amylin receptors.Couleur et forme :Odour Solid17-phenyl trinor Prostaglandin E2 ethyl amide
CAS :17-phenyl trinor PGE2 ethyl amide, an EP1/EP3 agonist (Ki: 14-54 nM), enhances lipid solubility and tissue uptake, is a potent antifertility agent.Formule :C25H35NO4Couleur et forme :SolidMasse moléculaire :413.55Fluphenazine free base
CAS :Flufenazine: antipsychotic for schizophrenia, blocks dopamine D2 receptors, reduces hallucinations and delusions.Formule :C22H26F3N3OSCouleur et forme :SolidMasse moléculaire :437.52PA-8
CAS :PA-8: Selective PAC1 antagonist, orally active, blocks CREB phosphorylation & cAMP increase (IC50=2nM), reduces pain & aversive response in vivo.Formule :C17H18N4O4Degré de pureté :97.54%Couleur et forme :SolidMasse moléculaire :342.35Nα-Methylhistamine FA
Nα-Methylhistamine FA is a histamine H3 receptor agonistFormule :C7H13N3O2Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :171.2APP-FUBINACA
CAS :APP-FUBINACA is a cannabinoid receptor agonist, classified as a phenylalanine amide-based indazole-3-carboxamide derivative. It exhibits neurostimulatory effects.Formule :C24H21FN4O2Couleur et forme :SolidMasse moléculaire :416.45Human growth hormone-releasing factor
CAS :GHRH from the hypothalamus prompts the pituitary to produce/release GH by attaching to the GHRHR.Formule :C215H358N72O66SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :5039.65Bradykinin (1-6)
CAS :Bradykinin (1-6) is a stable, CPY-cleaved metabolite that triggers pain, induces muscle contractions, and activates NO synthetase.Formule :C30H45N9O8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :659.73Urocortin III (human)
CAS :Urocortin III, a human peptide, binds CRF-R2, affecting insulin via somatostatin feedback with K i values 13.5-100+ nM.Formule :C185H307N53O50S2Couleur et forme :SolidMasse moléculaire :4137.93Lobeline sulfate
CAS :Lobeline sulfate, an alkaloid like nicotine, aids in smoking cessation, insomnia, and respiratory issues. Less potent on nicotinic receptors.Formule :C22H29NO6SDegré de pureté :98%Couleur et forme :White PowderMasse moléculaire :435.54S33084
CAS :S33084 is a potent, selective and competitive antagonist of dopamine D(3)-receptors.Formule :C29H29N3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :451.56GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3850.31Thioperamide maleate
CAS :Thioperamide maleate (MR-12842 maleate) is an effective and selective antagonist of H3 receptor (Ki = 4.3 nM) for inhibition of [3H]histamine synthesis (Ki = 31Formule :C19H28N4O4SDegré de pureté :98.48%Couleur et forme :SolidMasse moléculaire :408.52Clozapine N-oxide dihydrochloride
CAS :Clozapine N-oxide dihydrochloride is a derivative of Clozapine and an agonist of DREADDs.Formule :C18H21Cl3N4ODegré de pureté :98.11%Couleur et forme :SolidMasse moléculaire :415.74MAO-B-IN-3
<p>MAO-B-IN-3 is a reversible, selective inhibitor of monoamine oxidase B (MAO-B) with an IC50 of 96 nM and demonstrates affinity for the 5-HT6 receptor with a Ki</p>Formule :C24H25N3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :387.47des-Gln14-Ghrelin TFA
Des-Gln14-Ghrelin TFA, a ligand for GHSR, boosts [Ca2+]i with an EC50 of 2.4 nM in CHO-GHSR62 cells.Formule :C144H238F3N43O42Couleur et forme :SolidMasse moléculaire :3300.69Kisspeptin-10, human
CAS :Kisspeptin-10, human is an effective vasoconstrictor and inhibitor of angiogenesis.Formule :C63H83N17O14Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1302.462Ilatreotide
CAS :Ilatreotide is a Amadori compound of octreotide.Formule :C61H86N10O20S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1343.53Apraglutide
CAS :Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Formule :C172H263N43O52Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3765.25Fsh receptor-binding inhibitor fragment(bi-10)
CAS :FSH antagonist bi-10 suppresses ovulation, induces follicular atresia, and may help in ovarian cancer by downregulating FSHR/ERβ.Formule :C42H67N13O19Couleur et forme :SolidMasse moléculaire :1058.0613,14-dihydro Prostaglandin F2α
CAS :13,14-dihydro Prostaglandin F2α (13,14-dihydro PGF2α) is the analog of PGF2α which has no unsaturation in the lower side chain.Formule :C20H36O5Couleur et forme :SolidMasse moléculaire :356.503Dolcanatide
CAS :Dolcanatide: oral GC-C agonist with laxative, pain-relief, and anti-inflammatory properties for IBD research.Formule :C65H104N18O26S4Couleur et forme :SolidMasse moléculaire :1681.8919(R)-hydroxy Prostaglandin E1
CAS :19(R)-hydroxy Prostaglandin E1 is an agonist of EP1 and EP3 receptor subtypes and exhibits contractile activity on smooth muscle and is the major prostaglandinFormule :C20H34O6Couleur et forme :SolidMasse moléculaire :370.486Xylamidine
CAS :Xylamidine is a biochemical.Formule :C19H24N2O2Couleur et forme :SolidMasse moléculaire :312.41Lamprey LH-RH I
CAS :Lamprey LH-RH I triggers ovulation and raises steroid levels in lamprey, inactive in other species.Formule :C58H79N15O15Couleur et forme :SolidMasse moléculaire :1226.34Semaglutide TFA
Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patientsFormule :C189H290F3N45O61Degré de pureté :99.69% - 99.94%Couleur et forme :SolidMasse moléculaire :4225.6482EP4 receptor antagonist 3
CAS :EP4 receptor antagonist 3 from patent WO2010019796 A1 targets EP4 for research on pain, arthritis, and cancer.Formule :C26H21F3N2O3SCouleur et forme :SolidMasse moléculaire :498.52[Asu1,6-Arg8]Vasopressin
CAS :[Asu1,6-Arg8]Vasopressin, a vasopressin agonist, boosts cAMP and ACTH release in cultured rat pituitary cells.Formule :C48H68N14O12Couleur et forme :SolidMasse moléculaire :1033.14Satoreotide
CAS :Satoreotide (JR11) is an SSTR2 antagonist, typically conjugated with radiolabeled chelators for use in neuroendocrine tumor imaging [1].Formule :C58H72ClN15O14S2Couleur et forme :SolidMasse moléculaire :1302.87[Sar4] Substance P (4-11)
'[Sar4] Substance P (4-11) is a C-terminus fragment and agonist of Substance P.'Formule :C44H65N11O10SCouleur et forme :SolidMasse moléculaire :940.12(D-Phe7)-α-MSH
CAS :(D-Phe7)-α-MSH is an α-MSH analogue [1] .Formule :C77H109N21O19SCouleur et forme :SolidMasse moléculaire :1664.88NI-203
NI-203 is a monoclonal antibody inhibitor that targets amylin and shows potential for research in type 2 diabetes.Couleur et forme :Odour LiquidProtease-Activated Receptor-1, PAR-1 Agonist
CAS :Selective peptide agonist that mimics thrombin to activate PAR-1 receptor, enabling targeted receptor activation.Formule :C35H58N10O9Couleur et forme :SolidMasse moléculaire :762.91LY 293284
CAS :LY 293284 is a potent, selective full agonist of 5-HT1A receptor with anxiogenic effects in animal studies.Formule :C19H26N2OCouleur et forme :SolidMasse moléculaire :298.42PAR-2 (1-6) (human)
CAS :PAR-2 (1-6) (human) (SLIGKV), a peptide ligand, is a PAR-2 agonist [1] .Formule :C28H53N7O8Couleur et forme :SolidMasse moléculaire :615.76sGC activator 2
sGC activator 2 (Compound 16a) acts as an activator of soluble guanylate cyclase (sGC), enhancing the production of cGMP and exhibiting vasoprotective and anti-inflammatory properties.Formule :C21H21FN8O3Couleur et forme :SolidMasse moléculaire :452.444-Methylamphetamine hydrochloride
CAS :4-Methylamphetamine hydrochloride is a 5-HT1A receptor agonist that induces a decrease in body temperature in rats by binding to the 5-HT1A receptor. Additionally, it increases the extracellular levels of neurotransmitters norepinephrine (NE), dopamine (DA), and serotonin (5-HT) by affecting their transporters. 4-Methylamphetamine hydrochloride is applicable in the study of neurological disorders.Formule :C10H16ClNCouleur et forme :SolidMasse moléculaire :185.69[D-p-Cl-Phe6,Leu17]-VIP TFA
[D-p-Cl-Phe6,Leu17]-VIP TFA acts as a competitive and selective antagonist of the vasoactive intestinal peptide (VIP) receptor, exhibiting an IC50 of 125.8 nM.Formule :C150H240F3ClN44O44Couleur et forme :SolidMasse moléculaire :3456.22LY 344864 racemate
CAS :LY 344864 racemate is a 5-HT1F receptor agonist.Formule :C21H22FN3ODegré de pureté :99.75%Couleur et forme :SoildMasse moléculaire :351.42Nadolol
CAS :<p>Nadolol is a non-selective beta-adrenergic antagonist with antihypertensive and antiarrhythmic activities.</p>Formule :C17H27NO4Degré de pureté :99.87% - 99.92%Couleur et forme :White To Off-White Crystalline Powder SolidMasse moléculaire :309.40Prostaglandin E2 isopropyl ester
CAS :PGE2 isopropyl ester, a lipophilic prodrug of PGE2, gains solubility in lipids and activates upon in vivo hydrolysis.Formule :C23H38O5Couleur et forme :SolidMasse moléculaire :394.552T-kinin
CAS :T-kinin (Ile-Ser-bradykinin) is a bradykinin-containing peptide utilized in inflammation research [1] [2].Formule :C59H89N17O14Masse moléculaire :1260.44Sarafotoxin S6a
CAS :Endothelin receptor agonist (EC50 values are 7.5 and > 150 nM for contraction of pig coronary artery and guinea pig aorta respectively). Nociceptive in vivo.Formule :C105H156N28O34S5Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2514.85Synephrine hemitartrate
CAS :Synephrine hemitartrate, an alkaloid from Citrus aurantium, is a sympathomimetic for weight loss, with α and β-adrenergic action.Formule :C9H13NO2C4H6O6Couleur et forme :SolidMasse moléculaire :242.26MrgprX2 antagonist-3
CAS :MrgprX2 antagonist-3 (compound E117) is a MrgprX2 antagonist applicable for investigating cutaneous inflammation.Formule :C16H20FN3O2SDegré de pureté :98.06%Couleur et forme :SolidMasse moléculaire :337.41Ref: TM-T40271
1mg57,00€5mg120,00€10mg190,00€25mg383,00€50mg604,00€100mg965,00€1mL*10mM (DMSO)134,00€FR252384
CAS :FR252384 is an antagonist of the neuropeptide Y-Y5 receptor (IC50: 2.3 nM).Formule :C18H17N3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :275.35
![[Asu1,6-Arg8]Vasopressin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76510.webp&w=3840&q=75)
