GPCR/G-Protéine
Les inhibiteurs des GPCR/protéines G sont des composés qui ciblent les récepteurs couplés aux protéines G (GPCR) et les protéines G associées, qui jouent un rôle crucial dans la transmission des signaux de l'extérieur vers l'intérieur des cellules. Ces inhibiteurs sont essentiels pour étudier les voies de signalisation médiées par les GPCR, impliquées dans de nombreux processus physiologiques, y compris la perception sensorielle, la réponse immunitaire et la neurotransmission. Les inhibiteurs des GPCR sont également importants dans le développement de médicaments, car de nombreux agents thérapeutiques ciblent ces récepteurs. Chez CymitQuimica, nous offrons une large gamme d'inhibiteurs de GPCR/protéines G de haute qualité pour soutenir vos recherches en pharmacologie, biologie cellulaire et domaines connexes.
Sous-catégories appartenant à la catégorie "GPCR/G-Protéine"
- récepteur 5-HT(1.024 produits)
- Récepteur d'adénosine(249 produits)
- Récepteur adrénergique(3.030 produits)
- Récepteur de la bombésine(35 produits)
- Récepteur de la bradykinine(61 produits)
- CXCR(159 produits)
- CaSR(34 produits)
- Récepteur cannabinoïde(217 produits)
- Cholécystokinine(1 produits)
- Récepteur de la dopamine(443 produits)
- Récepteur de l'endothéline(86 produits)
- Récepteur GNRH(84 produits)
- GPCR19(33 produits)
- GRK(33 produits)
- GTPase(22 produits)
- Récepteur du glucagon(196 produits)
- Hérisson/Smoothened(49 produits)
- Récepteur de l'histamine(385 produits)
- Récepteur LPA(21 produits)
- Récepteur de la mélatonine(26 produits)
- Récepteur OX(42 produits)
- Récepteur opioïde(326 produits)
- PAFR(14 produits)
- PKA(53 produits)
- Récepteur S1P(17 produits)
- SGLT(31 produits)
- Récepteur Sigma(46 produits)
Affichez 19 plus de sous-catégories
5981 produits trouvés pour "GPCR/G-Protéine"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
α-Helical CRF(9-41) TFA
α-Helical CRF(9-41) TFA acts as a competitive antagonist for the CRF2 receptor, possessing a binding constant (K B) of approximately 100 nM.Formule :C168H275F3N46O55S2Couleur et forme :SolidMasse moléculaire :3940.42Corazonin
CAS :Corazonin, a neuropeptide in insects, regulates caste identity and behavior, mainly in workers/foragers.Formule :C62H83N17O19Couleur et forme :SolidMasse moléculaire :1370.42dCNP
<p>dCNP binds to NPR-B/C receptors (NPR-B/C receptor), initiating the cGMP signaling pathway and regulating vascular function. It exhibits anti-hypoxic effects by downregulating hypoxia-related genes such as HIF1α and HIF2α. Additionally, dCNP inhibits tumor stroma induction, demonstrating antifibrotic properties. It also enhances immune response by upregulating CTL, NK cells, and conventional type 1 dendritic cells in tumors.</p>Formule :C141H248N38O36S3Couleur et forme :SolidMasse moléculaire :3147.91Neurokinin Receptor (393-407), rat
CAS :Rat NK1R fragment (393-407) binds SP, enabling endocytosis and plasma membrane recycling; key in neurogenic inflammation research.Formule :C72H113N17O26S2Couleur et forme :SolidMasse moléculaire :1696.9[His1,Nle27] GHRF (1-32), amide, human
CAS :<p>[His1,Nle27] GHRF (1-32), amide, human is a potent GHRH analog with high GHRHR affinity.</p>Formule :C159H265N51O46Couleur et forme :SolidMasse moléculaire :3627.12ANP [Des18-22] 4-23 amide rat
CAS :<p>ANP [Des18-22] 4-23 amide rat is a peptide fragment of rat atrial natriuretic peptide (ANP) that specifically binds to NPR-C.</p>Formule :C64H107N25O19S2Couleur et forme :SolidMasse moléculaire :1594.82Utreglutide
CAS :Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formule :C191H298N46O58Couleur et forme :SolidMasse moléculaire :4166.67Substance P (4-11)
CAS :Substance P (4-11), a C-terminal fragment of Substance P, acts as a highly selective agonist for NK1 receptors, demonstrating specificity in its interaction.Formule :C46H67N11O10SCouleur et forme :SolidMasse moléculaire :966.16MLGFFQQPKPR-NH2
CAS :MLGFFQQPKPR-NH2 is a reversed Substance P peptide. Substance P is a neuropeptide [1] .Formule :C63H98N18O13SCouleur et forme :SolidMasse moléculaire :1347.63Neuropeptide W-30 (rat)
CAS :Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].Formule :C165H249N49O38SCouleur et forme :SolidMasse moléculaire :3559.11AZ7976
CAS :AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].Formule :C30H33F7N2O6SCouleur et forme :SolidMasse moléculaire :682.65γ-1-Melanocyte Stimulating Hormone (MSH), amide
γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and bloodFormule :C72H97N21O14SCouleur et forme :SolidMasse moléculaire :1512.9CGRP 8-37 (rat)
CAS :CGRP 8-37 (rat) is a CGRP receptor antagonist, a CGRP fragment with potential anti-injury effects that induces arterial relaxation.Formule :C138H224N42O41Degré de pureté :99.28%Couleur et forme :SolidMasse moléculaire :3127.51FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3692.15PACAP (1-38) free acid TFA
PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrinCouleur et forme :Odour SolidPAMP-12 (unmodified) (TFA)
PAMP-12 (unmodified) TFA, an endogenous peptide and potent MRGPRX2 (MrgX2) agonist (EC50=20-50 nM), induces hypotension by inhibiting catecholamine secretionFormule :C79H119F3N24O17Couleur et forme :SolidMasse moléculaire :1733.94PG-931 TFA
PG-931 TFA, a potent MC4 receptor agonist (IC50 0.58 nM), excels in selectivity and helps reverse hemorrhagic shock in vivo.Formule :C61H86F3N15O13Couleur et forme :SolidMasse moléculaire :1294.42(2R,2R)-PF-07258669
CAS :<p>(2R,2R)-PF-07258669' is an antagonist for the MC4R (melanocortin 4 receptor), primarily studied for its role in regulating appetite and energy expenditure.</p>Formule :C25H27FN6O2Couleur et forme :SolidMasse moléculaire :462.52Melanostatin, frog
CAS :Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2].Formule :C189H285N53O57SCouleur et forme :SolidMasse moléculaire :4243.67α-CGRP(human) TFA
α-CGRP(human) TFA is a 37-amino acid regulatory neuropeptide that is extensively located within the central and peripheral nervous system, functioning as aFormule :C165H268F3N51O51S2Couleur et forme :SolidMasse moléculaire :3903.33Neuropeptide Y (3-36) (human, rat)
CAS :Neuropeptide Y (3-36) is a Y2 receptor agonist that limits norepinephrine release, produced by DPP4 from NPY.Formule :C175H269N53O54SCouleur et forme :SolidMasse moléculaire :4011.5Prepro-ANF (56-92), human
CAS :Human prepro-ANF (56-92) activates renal guanylate cyclase and boosts its activity.Formule :C173H270N44O57Couleur et forme :SolidMasse moléculaire :3878.26Protease-Activated Receptor-1, PAR-1 Agonist TFA
PAR-1 Agonist TFA: Selective peptide, mimics thrombin, activates PAR-1 receptor.Couleur et forme :Liquid(Trp7,β-Ala8)-Neurokinin A (4-10)
CAS :(Trp7,β-Ala8)-Neurokinin A (4-10) is a potent neurokinin-3 (NK3) antagonist [1] .Formule :C41H57N9O10SCouleur et forme :SolidMasse moléculaire :868.01Cyclosomatostatin TFA
Cyclosomatostatin TFA blocks SST receptor, reduces CRC cell growth, ALDH+ size, and sphere-formation.Formule :C46H58F3N7O8Couleur et forme :SolidMasse moléculaire :893.99Sauvagine TFA
Sauvagine TFA: frog-derived, 40-amino-acid CRF agonist; stimulates ACTH release, affects diuresis, cardiovascular system, endocrine glands.Formule :C204H347F3N56O65S1Couleur et forme :SolidMasse moléculaire :4713.33(Phe2,Orn8)-Oxytocin
CAS :(Phe2,Orn8)-Oxytocin: Selective V1 agonist, induces rabbit epididymis contractility, EC50=280 nM.Formule :C42H65N13O11S2Couleur et forme :SolidMasse moléculaire :992.18AC 187 TFA
AC 187 TFA, a potent and orally active amylin receptor antagonist, exhibits an IC50 of 0.48 nM and a Ki of 0.275 nM.Formule :C129H206F3N37O42Couleur et forme :SolidMasse moléculaire :3004.27Kisspeptin-10, rat TFA
<p>Kisspeptin-10, a rat TFA, constricts blood vessels, inhibits vessel growth, and counters Methotrexate reproductive toxicity.</p>Formule :C65H84F3N17O17Couleur et forme :SolidMasse moléculaire :1432.46Guanylin(human) TFA
Guanylin (human) TFA, a 15-amino acid peptide, activates intestinal guanylate cyclase, regulating electrolyte and water transport via cGMP.Couleur et forme :Liquid[Lys4] Sarafotoxin S6c
CAS :[Lys4] Sarafotoxin S6c: potent partial endothelin receptor agonist; causes pig coronary contraction, EC50=1.5 nM.Formule :C105H153N27O36S5Couleur et forme :SolidMasse moléculaire :2529.82[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat
CAS :[Tyr22] CGRP (22-37), rat is a fragment of rat CGRP, targeting its receptor and adenylate cyclase, produced by thyroid and stored in the nervous system.Formule :C82H120N20O25Couleur et forme :SolidMasse moléculaire :1785.95Angiopeptin
CAS :<p>Angiopeptin is a synthetic octapeptide analog of somatostatin; suppresses accelerated transplant atherosclerosis in rabbit heart arteries.</p>Formule :C54H71N11O10S2Couleur et forme :SolidMasse moléculaire :1098.34ZL-1101
ZL-1101 is a human monoclonal antibody (mAb) targeting TNFRSF4/OX40/CD134.Couleur et forme :Odour Liquida-Helical Corticotropin Releasing Factor (9-41)
CAS :α-Helical CRF (9-41) is a CRF antagonist that lowers in vivo plasma GH levels.Formule :C166H273N45O54S2Couleur et forme :SolidMasse moléculaire :3827.34Relaxin H3 (human)
CAS :Relaxin H3 (human) is a relaxin peptide that exhibits antifibrotic effects through activation of RXFP1 [1].Couleur et forme :SolidGLP-1R agonist 19
CAS :GLP-1R agonist 19 (M3190) is a potent, selective GLP-1 receptor agonist that demonstrates excellent plasma and liver microsomal stability, along with low hERG toxicity [1].Formule :C94H136FN21O25Couleur et forme :SolidMasse moléculaire :1979.21[Nle13]-Motilin
CAS :[Nle13]-Motilin, a motilin analogue, is a motilin receptor agonist [1] [2] .Formule :C121H190N34O35Couleur et forme :SolidMasse moléculaire :2681.01Vazegepant
CAS :Vazegepant is an intranasal CGRP receptor antagonist utilized for conducting acute migraine research.Formule :C36H46N8O3Degré de pureté :98.61% - 99.98%Couleur et forme :SolidMasse moléculaire :638.80Ref: TM-T38734
1mg96,00€5mg227,00€10mg335,00€25mg567,00€50mgÀ demander100mgÀ demander1mL*10mM (DMSO)305,00€ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat)
CAS :ACTH (3-24) is the fragment 3-24 of ACTH, used in disease research including cancer and immune disorders.Formule :C124H196N38O27SCouleur et forme :SolidMasse moléculaire :2683.19Azepexole hydrochloride
CAS :Azepexole hydrochloride (4H-Oxazolo[4,5-d]azepin-2-amine, 6-ethyl-5,6,7,8-tetrahydro-, hydrochloride (1:1)) is a potent α2-Adrenoceptor agonist with anaestheticFormule :C9H16ClN3ODegré de pureté :99.88% - 99.89%Couleur et forme :SoildMasse moléculaire :217.7Ceruletide Ammonium Salt
Ceruletide Ammonium Salt is a decapeptide, originating from the skin of tropical frogs, which is a potent cholecystokinin receptor agonist and a safe andFormule :C58H77N14O21S2Degré de pureté :98.47% - 98.54%Couleur et forme :SoildMasse moléculaire :1370.44Ref: TM-T14932L1
1mg87,00€5mg329,00€10mg490,00€25mg783,00€50mg1.035,00€100mg1.406,00€500mg2.783,00€1mL*10mM (DMSO)35,00€Neurokinin A(4-10)
CAS :Neurokinin A(4-10)(TFA) is an agonist of tachykinin NK2 receptor .Formule :C34H54N8O10SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :766.91[Ala17]-MCH acetate
[Ala17]-MCH acetate is a selective ligand for MCHR1 with a Ki of 0.16 nM and Kd of 0.37 nM(Eu3+ chelate-labeled).Formule :C99H159N29O28S4Degré de pureté :98.92%Couleur et forme :SolidMasse moléculaire :2331.765-HT1AR agonist 2
5-HT1AR Agonist 2 (Compound 4f) is a potent agonist of the 5-HT1A receptor with a Ki value of 10.0 nM. It also binds to SERT, D2, and 5-HT6 receptors with Ki values of 2.8 nM, 23 nM, and 192 nM, respectively. Furthermore, this compound demonstrates stability in microsomes and induces hypothermia in mice.Formule :C31H31N5O3Couleur et forme :SolidMasse moléculaire :521.61Boc-Phe-Leu-Phe-Leu-Phe
CAS :Boc-Phe-Leu-Phe-Leu-Phe is a chemotactic peptide antagonist that inhibits the release of peptide leukotrienes induced by FMLP.Formule :C44H59N5O8Couleur et forme :SolidMasse moléculaire :785.97σ1R-IN-1
σ1R-IN-1 ((R,R)-1a) is an effective σ-1R inhibitor with an IC50 of 110 nM. It shows promising potential for use in research related to neuropsychiatric disorders.Formule :C15H22N2Couleur et forme :SolidMasse moléculaire :230.35MD01-67
CAS :MD01-67 is a macrocyclic compound selectively targeting the neurotensin 2 receptor (NTS2), with a Ki of 2.9 nM. It exhibits analgesic activity and reduces tactile hypersensitivity in rat models of acute, sustained, and chronic inflammatory pain.Formule :C37H58N8O8Couleur et forme :SolidMasse moléculaire :742.91Setmelanotide Acetate(920014-72-8 free base)
CAS :Setmelanotide Acetate(920014-72-8 free base) (RM-493 Acetate) is a selective agonist of melanocortin 4 receptor (MC4R)(human and rat MC4R with EC50s of 0.27 nMFormule :C51H72N18O11S2Degré de pureté :99.71%Couleur et forme :SolidMasse moléculaire :1177.35Ref: TM-T12882L
1mg131,00€5mg286,00€10mg430,00€25mg710,00€50mg998,00€100mg1.349,00€1mL*10mM (DMSO)555,00€Noladin ether
CAS :Noladin ether (2-AG ether) is a cannabinoid CB1 receptor agonist.Formule :C23H40O3Couleur et forme :SolidMasse moléculaire :364.56
![ANP [Des18-22] 4-23 amide rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP3030.webp&w=3840&q=75)
![[Lys4] Sarafotoxin S6c](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76302.webp&w=3840&q=75)
![[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76363.webp&w=3840&q=75)
![[Nle13]-Motilin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76359.webp&w=3840&q=75)
![[Ala17]-MCH acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1997L.webp&w=3840&q=75)
