Proteina G/GPCR
Gli inibitori dei GPCR/proteine G sono composti che bersagliano i recettori accoppiati alle proteine G (GPCR) e le proteine G associate, che svolgono ruoli critici nella trasmissione dei segnali dall'esterno all'interno delle cellule. Questi inibitori sono essenziali per studiare le vie di segnalazione mediate dai GPCR, coinvolte in numerosi processi fisiologici, tra cui la percezione sensoriale, la risposta immunitaria e la neurotrasmissione. Gli inibitori dei GPCR sono anche importanti nello sviluppo di farmaci, poiché molti agenti terapeutici prendono di mira questi recettori. Presso CymitQuimica, offriamo una vasta gamma di inibitori dei GPCR/proteine G di alta qualità per supportare le tue ricerche in farmacologia, biologia cellulare e campi correlati.
Sottocategorie di "Proteina G/GPCR"
- recettore 5-HT(939 prodotti)
- Recettore dell'adenosina(242 prodotti)
- Recettore adrenergico(2.945 prodotti)
- Recettore della bombesina(30 prodotti)
- Recettore della bradichinina(59 prodotti)
- CXCR(148 prodotti)
- CaSR(32 prodotti)
- Recettore dei cannabinoidi(195 prodotti)
- Recettore della dopamina(407 prodotti)
- Recettore dell'endotelina(76 prodotti)
- Recettore GNRH(73 prodotti)
- GPCR19(31 prodotti)
- GRK(31 prodotti)
- GTPase(21 prodotti)
- Recettore del glucagone(165 prodotti)
- Proteina Hedgehog/Smoothened(44 prodotti)
- Recettore dell'istamina(358 prodotti)
- Recettore LPA(21 prodotti)
- Recettore della melatonina(24 prodotti)
- Recettore OX(40 prodotti)
- Recettore degli oppioidi(297 prodotti)
- PAFR(11 prodotti)
- PKA(48 prodotti)
- Recettore S1P(17 prodotti)
- SGLT(30 prodotti)
- Recettore Sigma(46 prodotti)
Mostrare 18 più sottocategorie
Trovati 5352 prodotti di "Proteina G/GPCR"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
PSB-SB-1203
CAS:<p>PSB-SB-1203 (Compound 25b) is a dual CB1/CB2 ligand that blocks the CB1 receptor and activates the CB2 receptor with a CB1 Ki of 0.244 μM, a CB2 Ki of 0.210 μM, and an EC50 of 0.054 μM. It shows potential for research in obesity and cancer.</p>Formula:C25H30O4Colore e forma:SolidPeso molecolare:394.5S1R agonist 2
CAS:<p>S1R agonist 2 is a selective S1R agonist with a Ki of 88 nM for S2R and 1.1 nM for S1R and is protective against ROS and NMDA-induced neurotoxicity.</p>Formula:C21H27NOPurezza:98.85%Colore e forma:SolidPeso molecolare:309.45Afubiata
CAS:<p>ADB-FUBIATA is a synthetic cannabinoid studied for its metabolic profile, along with AFUBIATA, CH-FUBIATA, and CH-PIATA. This in vitro analysis by Watanabe S, et al., examines these compounds, as published in "Arch Toxicol," 2023 Dec;97(12):3085-3094.</p>Formula:C27H29FN2OColore e forma:SolidPeso molecolare:416.53exo-Tetrahydrocannabivarin
CAS:<p>exo-Tetrahydrocannabivarin (Compound 12) is an analog of Δ9,11-THC. It weakly binds to cannabinoid receptors (CB) with an IC50 of 1.4 μM. In mice, exo-Tetrahydrocannabivarin exhibits activity related to both motor function and analgesia.</p>Formula:C19H26O2Colore e forma:SolidPeso molecolare:286.414-Hydroxy MPT
CAS:<p>4-Hydroxy MPT (4-OH-MPT) is a serotonin-active compound that acts as an agonist for 5-HT2A and 5-HT2B receptors, with EC50 values of 3.82 nM and 3.4 nM, respectively.</p>Formula:C14H20N2OColore e forma:SolidPeso molecolare:232.325-HT2A receptor agonist-6
CAS:<p>5-HT2A receptor agonist-6 (compound 47) is a selective agonist of the 5-HT2A receptor with a pEC50 value of 6.58.</p>Formula:C18H19N3O3Colore e forma:SolidPeso molecolare:325.36Prostaglandin K1
CAS:<p>Prostaglandin K1 (compound 46) is a structurally modified prostanoid analog with an EC50 and Ki of 2800 nM for the EP1 receptor.</p>Formula:C20H32O5Colore e forma:SolidPeso molecolare:352.47MLS1082
CAS:<p>MLS1082 is a D1-like dopamine receptor (D1R) orthosteric modulatothat stimulates G-protein signaling upon dopamine activation for neurodegenerative disorders.</p>Formula:C24H23N3O2Purezza:99.53%Colore e forma:SolidPeso molecolare:385.46FFN246
CAS:<p>FFN246, a fluorescent probe, concurrently targets the serotonin transporter (SERT) and vesicular monoamine transporter 2 (VMAT2), exhibiting excitation and</p>Formula:C15H13FN2OPurezza:98%Colore e forma:SolidPeso molecolare:256.27Emoghrelin
CAS:<p>Emoghrelin, extracted from Heshouwu (Polygonum multiflorum), promotes the secretion of growth hormone by activating the ghrelin receptor [1].</p>Formula:C24H22O13Purezza:98%Colore e forma:SolidPeso molecolare:518.42α-CGRP (mouse, rat) TFA
<p>α-CGRP (mouse, rat) TFA, a neuropeptide belonging to the calcitonin gene-related peptide (CGRP) family, is predominantly located at neuromuscular junctions and</p>Formula:C162H262N50O52S2·C2HF3O2Purezza:98%Colore e forma:SolidPSB-1114 triethylamine
<p>PSB-1114 triethylamine is a potent, enzymatically stable, P2Y2 receptor agonist with a 134 nM EC50, exhibiting greater than 50-fold selectivity over P2Y4 (EC50</p>Formula:C10H15F2N3O13P3S·xC6H15NPurezza:98%Colore e forma:SolidMuscarinic toxin 3
CAS:<p>Muscarinic toxin 3 (MT3), a potent non-competitive antagonist of mAChR and adrenoceptors, exhibits pIC50 values of 6.71 for M1, 8.79 for M4, 8.86 for α1A, 7.57</p>Formula:C319H489N89O97S8Purezza:98%Colore e forma:SolidPeso molecolare:7379.35AB21 oxalate
<p>AB21 oxalate, a potent and selective S1R antagonist, exhibits binding affinities (Kis) of 13 nM and 102 nM for S1R and S2R, respectively.</p>Formula:C25H30N2O5Purezza:98%Colore e forma:SolidPeso molecolare:438.525-HT6 agonist 1
Compound 19, a 5-HT6 agonist with an affinity (K i : 5 nM), exhibits antidepressant-like effects and enhances cognitive function while also inhibiting plateletFormula:C17H22Cl2N6SPurezza:98%Colore e forma:SolidPeso molecolare:413.37human GALP (3-32)
<p>Human GALP (3-32) (Galanin-like peptide (3-32)) serves as a high-affinity agonist for galanin receptors GalR1 (IC50 = 33 nM) and GalR2 (IC50 = 15 nM), as</p>Formula:C137H213N43O38SPurezza:98%Colore e forma:SolidPeso molecolare:3102.49JPC0323
<p>JPC0323 is a dual positive allosteric modulator of the 5-HT2C and 5-HT2A receptors, featuring on-target properties, acceptable plasma exposure, and adequate</p>Formula:C22H43NO4Purezza:98%Colore e forma:SolidPeso molecolare:385.58PSB 0777 ammonium hydrate
<p>PSB 0777 ammonium hydrate is a potent and selective adenosine A2A receptor full agonist, exhibiting K i values of 44.4 nM for rat A2A receptors and 360 nM for</p>Formula:C18H20N5O7S2·NH4·75H2OPurezza:98%Colore e forma:SolidPeso molecolare:532.09D3R ligand 1
<p>D3R Ligand 1 (compound 23b) is a potent, selective antagonist of the dopamine D3 receptor (Ki=66 nM), incorporating a THPB template.</p>Formula:C27H37NO5Purezza:98%Colore e forma:SolidPeso molecolare:455.59PZ-1922
<p>PZ-1922 (Compound 16), able to cross the blood-brain barrier, is a dual antagonist for 5-HT6R and 5-HT3R with K i values of 17 nM and 0.45 nM, respectively.</p>Purezza:98%Colore e forma:Odour SolidACTH (7-38) (human)
CAS:<p>ACTH (7-38) (human) is a fragment (7-38) of the full human adrenocorticotropic hormone (ACTH (1-39)), also referred to as corticotropin inhibitory peptide (CIP</p>Formula:C167H257N47O46Purezza:98%Colore e forma:SolidPeso molecolare:3659.11Atrial natriuretic peptide (3-28) (human)
CAS:<p>Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)), a peptide hormone produced by the atrial myocardium, plays a critical role in the regulation of</p>Formula:C118H187N43O36S3Purezza:98%Colore e forma:SolidPeso molecolare:2880.21Conopeptide rho-TIA
CAS:<p>Conopeptide rho-TIA, a peptide from Conus tulipa venom, acts as a selective, noncompetitive inhibitor at the human α1B-Adrenergic Receptor and as a competitive</p>Formula:C105H160N36O21S4Purezza:98%Colore e forma:SolidPeso molecolare:2390.884-Methylhistamine
CAS:<p>4-Methylhistamine serves as a potent agonist for the histamine 4 receptor (H4R), holding promise for research into immune-related diseases, including cancer and</p>Formula:C6H11N3Purezza:98%Colore e forma:SolidPeso molecolare:125.17NXT-10796
<p>NXT-10796 is an orally active, intestinally restricted agonist of the EP4 receptor [1].</p>Formula:C23H31N3O6Purezza:98%Colore e forma:SolidPeso molecolare:445.51Sigma-1 receptor antagonist 4
<p>Sigma-1 receptor antagonist 4 (Compound 32) is a potent σ1R antagonist that significantly enhances morphine's analgesic effects and reverses morphine-induced</p>Formula:C22H26N2OColore e forma:SolidPeso molecolare:334.45Corticotropin-releasing factor (human) acetate
<p>Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary.</p>Purezza:98.30%Colore e forma:LiquidKSK94 FA
<p>KSK94 FA is a potent histamine H3 receptor antagonist that inhibits H3 receptors and is used in the study of neuropathic pain and obesity.</p>Formula:C26H28N4O3Purezza:97.51%Colore e forma:SoildPeso molecolare:444.53Cholecystokinin (26-33) free acid
CAS:<p>Cholecystokinin (26-33) free acid is part of CCK and induces mild taste aversion conditioning in rats.</p>Formula:C49H61N9O14S2Purezza:99.14%Colore e forma:SoildPeso molecolare:1064.19Adatanserin hydrochloride
CAS:<p>Adatanserin hydrochloride (WY50324 hydrochloride) is a 5-HT(1A)/5-HT(2) receptor ligand that is neuroprotective and may be used in the study of depression.</p>Formula:C21H32ClN5OPurezza:99.64%Colore e forma:SolidPeso molecolare:405.96Binospirone
CAS:<p>Binospirone (MDL 73005EF) is a 5-HT1A receptor agonist with anxiolytic activity used in the study of movement disorders associated with neurologic dysfunction.</p>Formula:C20H26N2O4Purezza:97.57% - 98.96%Colore e forma:SoildPeso molecolare:358.43Lanepitant 2HCl
CAS:<p>Lanepitant 2HCl is a non-peptide neurokinin-1 receptor antagonist that can be used to study painful neuropathy-like disorders such as migraine.</p>Formula:C33H47Cl2N5O3Purezza:98.67%Colore e forma:SolidPeso molecolare:632.66Org 13011
CAS:<p>Org 13011 has CNS activity and induces conditioned taste aversion by mediating 5-HT 1A receptors.</p>Formula:C18H25F3N4OPurezza:98.02%Colore e forma:SoildPeso molecolare:370.41RS 56812
CAS:<p>RS 56812 is a 5-HT3 receptor antagonist and agonist used in the study of cognitive disorders.</p>Formula:C18H21N3O2Purezza:99.38%Colore e forma:SoildPeso molecolare:311.38Neuropeptide W-30 (rat)
CAS:<p>Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].</p>Formula:C165H249N49O38SColore e forma:SolidPeso molecolare:3559.11AZ7976
CAS:<p>AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].</p>Formula:C30H33F7N2O6SColore e forma:SolidPeso molecolare:682.65γ-1-Melanocyte Stimulating Hormone (MSH), amide
<p>γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and blood</p>Formula:C72H97N21O14SColore e forma:SolidPeso molecolare:1512.9Substance P (4-11)
CAS:Substance P (4-11), a C-terminal fragment of Substance P, acts as a highly selective agonist for NK1 receptors, demonstrating specificity in its interaction.Formula:C46H67N11O10SColore e forma:SolidPeso molecolare:966.16CAY10606
CAS:<p>CAY10606 has a wide range of applications in life science related research.</p>Formula:C22H18ClNO3Colore e forma:SolidPeso molecolare:379.84MLGFFQQPKPR-NH2
CAS:<p>MLGFFQQPKPR-NH2 is a reversed Substance P peptide. Substance P is a neuropeptide [1] .</p>Formula:C63H98N18O13SColore e forma:SolidPeso molecolare:1347.63FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Colore e forma:SolidPeso molecolare:3692.15K-(D-1-Nal)-FwLL-NH2 TFA
<p>K-(D-1-Nal)-FwLL-NH2 TFA: potent ghrelin inverse agonist; Ki=4.9 nM (COS7), 31 nM (HEK293T); blocks Gq/G13 signaling.</p>Formula:C53H68F3N9O8Colore e forma:SolidPeso molecolare:1016.16Human growth hormone-releasing factor TFA
<p>Human growth hormone-releasing factor TFA is a hypothalamic peptide that promotes GH secretion by targeting pituitary GHRHR.</p>Formula:C217H359F3N72O68SColore e forma:SolidPeso molecolare:5153.67ANQ-11125 TFA
<p>ANQ-11125 TFA is a motilin antagonist with a pKd of 8.24, inhibiting motilide contractions in rabbits.</p>Formula:C88H126F3N19O23Colore e forma:SolidPeso molecolare:1875.05Corazonin
CAS:<p>Corazonin, a neuropeptide in insects, regulates caste identity and behavior, mainly in workers/foragers.</p>Formula:C62H83N17O19Colore e forma:SolidPeso molecolare:1370.42MM 07
CAS:<p>Biased agonist for apelin/G protein pathway, enhances eNOS and cell growth, reduces apoptosis, improves heart function, and dilates vessels.</p>Formula:C67H106N22O14S3Purezza:98%Colore e forma:SolidPeso molecolare:1539.9dCNP
<p>dCNP binds to NPR-B/C receptors (NPR-B/C receptor), initiating the cGMP signaling pathway and regulating vascular function. It exhibits anti-hypoxic effects by downregulating hypoxia-related genes such as HIF1α and HIF2α. Additionally, dCNP inhibits tumor stroma induction, demonstrating antifibrotic properties. It also enhances immune response by upregulating CTL, NK cells, and conventional type 1 dendritic cells in tumors.</p>Formula:C141H248N38O36S3Colore e forma:SolidPeso molecolare:3147.91Neuropeptide Y (18-36) (porcine)
CAS:<p>"Neuropeptide Y (18-36) (porcine) is a NPY heart receptor blocker, halts I-NPY binding, aids in heart failure research."</p>Formula:C112H174N36O27Colore e forma:SolidPeso molecolare:2456.8SYD5115
<p>SYD5115 is an orally active TSH-R antagonist.</p>Formula:C22H32F2N4O3Peso molecolare:438.24425ACT-1016-0707
CAS:<p>ACT-1016-0707 is a selective, insurmountable LPA1 antagonist with antifibrotic and anti-inflammatory activity in lung fibrosis models</p>Formula:C19H23ClN4O4SPurezza:99.905%Colore e forma:SolidPeso molecolare:438.93Cortistatin 14, human, rat
CAS:<p>Cortistatin 14: a neuropeptide similar to somatostatin; induces sleep, depresses neuronal activity; found in cortex, hippocampus.</p>Formula:C81H113N19O19S2Purezza:98%Colore e forma:SolidPeso molecolare:1721.01Hemokinin 1, human TFA
<p>Hemokinin-1 is a human TFA and selective NK1 agonist; also activates NK2 & NK3 and induces opioid-independent analgesia.</p>Formula:C56H85F3N14O16SColore e forma:SolidPeso molecolare:1299.42PROTAC(H-PGDS)-8
CAS:<p>PROTAC(H-PGDS)-8 is a PROTAC degrader targeting Hematopoietic prostaglandin D synthase (H-PGDS), exhibiting an IC50 of 0.14 μM [1].</p>Formula:C41H40N8O7Colore e forma:SolidPeso molecolare:756.81BAY-747
CAS:<p>BAY-747: oral, brain-penetrant sGC stimulator; improves rat memory, cognition, lowers blood pressure, aids Duchenne muscular dystrophy.</p>Formula:C22H26F2N4O2Colore e forma:SolidPeso molecolare:416.469-deoxy-9-methylene Prostaglandin E2
CAS:<p>9-deoxy-9-methylene PGE2: stable PGE2 analog with similar effects, less side effects, equal potency in rats, gerbils, primates.</p>Formula:C21H34O4Colore e forma:SolidPeso molecolare:350.499PG106 TFA
<p>PG106 TFA is a potent hMC3 antagonist (IC50=210 nM), inactive at hMC4 (EC50=9900 nM) and hMC5 receptors.</p>Formula:C53H70F3N13O11Colore e forma:SolidPeso molecolare:1122.2PF-232798
CAS:<p>PF-232798 is a second generation oral CCR5 antagonist with potent broad-spectrum anti-HIV-1 activity.</p>Formula:C29H40FN5O2Colore e forma:SolidPeso molecolare:509.66LY 344864 racemate
CAS:<p>LY 344864 racemate is a 5-HT1F receptor agonist.</p>Formula:C21H22FN3OPurezza:99.75%Colore e forma:SoildPeso molecolare:351.42PAR 4 (1-6)
CAS:<p>PAR 4 (1-6) can be used for relevant research in the life sciences. Its product number is T36293 and CAS number is 225779-44-2.</p>Formula:C28H41N7O9Colore e forma:SolidPeso molecolare:619.676Ro60-0175
CAS:<p>Ro60-0175 is a selective 5-HT2B and 5-HT2C serotonin receptor agonist, often used as fumarate.</p>Formula:C11H12ClFN2Purezza:97.09%Colore e forma:SolidPeso molecolare:226.68SB-408124
CAS:<p>SB408124: Non-peptide, OX1 receptor antagonist, Ki 57 nM (whole cell) and 27 nM (membrane), 50x more selective than OX2.</p>Formula:C19H18F2N4OPurezza:99.81%Colore e forma:SolidPeso molecolare:356.37EP4 receptor antagonist 3
CAS:<p>EP4 receptor antagonist 3 from patent WO2010019796 A1 targets EP4 for research on pain, arthritis, and cancer.</p>Formula:C26H21F3N2O3SColore e forma:SolidPeso molecolare:498.52GHRF, porcine
CAS:<p>GHRF, porcine, a growth hormone releasing factor (GHRF) peptide (porcine), binds to the growth hormone secretagogue receptor (GHSR), thereby inducing the</p>Formula:C219H365N73O66SColore e forma:SolidPeso molecolare:5108.76PACAP (1-38) free acid TFA
<p>PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin</p>Colore e forma:Odour SolidCyclic AC253
<p>Cyclic AC253 is an amylin receptor antagonist with an IC50 of 0.3 μM. It offers neuroprotective effects against Aβ toxicity and mitigates Aβ-induced impairments in hippocampal long-term potentiation. Additionally, Cyclic AC253 is capable of penetrating the blood-brain barrier.</p>Formula:C126H202N42O40S2Peso molecolare:3007.45049Upidosin
CAS:<p>Upidosin (SB-216469), a uroselective α1 blocker: Ki α1a=0.34 nM, α1b=3.9 nM, α1d=1.5 nM, α2=33.3 nM.</p>Formula:C31H33N3O4Purezza:99.66%Colore e forma:SolidPeso molecolare:511.61[Sar9] Substance P
CAS:<p>[Sar9]-Substance P is one of NK-1 receptor agonist. The action of SP on progesterone metabolism was mimicked by the rNK1-specific agonist [Sar-9,Met(O2)11]-SP.</p>Formula:C64H100N18O13SPurezza:98%Colore e forma:SolidPeso molecolare:1361.66GPR55 agonist 4
<p>GPR55 agonist 4 (Compound 28), with an EC50 of 131 nM for hGPR55 and 1.41 nM for rGPR55, effectively induces β-arrestin recruitment to human GPR55 [1].</p>Formula:C19H16FN5O2Colore e forma:SolidPeso molecolare:365.36Bradykinin (1-6)
CAS:<p>Bradykinin (1-6) is a stable, CPY-cleaved metabolite that triggers pain, induces muscle contractions, and activates NO synthetase.</p>Formula:C30H45N9O8Purezza:98%Colore e forma:SolidPeso molecolare:659.73Benzomalvin B
CAS:<p>Benzomalvin B, a metabolite from Penicillium, blocks 24% NK1 receptor binding at 100 μg/ml.</p>Formula:C24H17N3O2Colore e forma:SolidPeso molecolare:379.419O-Desethyl Dapagliflozin
CAS:<p>O-Desethyl Dapagliflozin (Empagliflozin-4) is a SGLT2 inhibitor, IC50=33nM.</p>Formula:C19H21ClO6Purezza:98.33%Colore e forma:SolidPeso molecolare:380.82Upacicalcet HCl
<p>Upacicalcet HCl, a calcium mimetic, reduces blood PTH by targeting parathyroid receptors; treats secondary hyperparathyroidism.</p>Formula:C11H15Cl2N3O6SPurezza:98.56%Colore e forma:SoildPeso molecolare:388.22BIBP3226
CAS:<p>BIBP3226 is a potent and selective antagonist for the Neuropeptide Y receptor Y1 and the neuropeptide FF receptor.</p>Formula:C27H31N5O3Colore e forma:SolidPeso molecolare:473.57Detomidine carboxylic acid
CAS:<p>Detomidine carboxylic acid, a urine metabolite of detomidine, is a synthetic α2-agonist, animal analgesic, with cardiac, respiratory, and diuretic effects.</p>Formula:C12H12N2O2Purezza:98%Colore e forma:SolidPeso molecolare:216.248-iso Prostaglandin E2
CAS:<p>"8-iso PGE2: Isoprostane from arachidonic acid, potent rat renal vasoconstrictor, reduces GFR and renal flow by 80%, no BP effect."</p>Formula:C20H32O5Colore e forma:SolidPeso molecolare:352.47Lys-γ3-MSH(human)
CAS:<p>Pro-opiomelanocortin (POMC) derived peptide that stimulates lipolysis</p>Formula:C128H193N45O39SPurezza:98%Colore e forma:SolidPeso molecolare:3018.25Neuropeptide Y (13-36), amide, human
CAS:<p>Neuropeptide Y (13-36), amide, human is a neuropeptide Y receptor agonist.</p>Formula:C134H207N41O36SPurezza:98%Colore e forma:SolidPeso molecolare:3000.4CCR4 antagonist 3 hydrochloride
CAS:<p>Orally active CCR4 antagonist 3 hydrochloride with potent selectivity, IC50s: 22/50 nM; has antitumor properties.</p>Formula:C24H27Cl2N7O·xHClColore e forma:SolidGLP-1R agonist 16
CAS:<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Formula:C50H58FN10O6PColore e forma:SolidPeso molecolare:945.03Donitriptan hydrochloride
CAS:<p>Donitriptan hydrochloride (Donitriptan monohydrochloride) is a potent, high efficacy agonist of 5-HT1B/1D receptors with pKis of 9.4 and 9.3, respectively</p>Formula:C23H26ClN5O2Purezza:99.8% - 99.86%Colore e forma:SolidPeso molecolare:439.94Bz-Dab(nbd)-awfpp-nle-NH2
CAS:<p>Bz-Dab(nbd)-ala-trp-phe-pro-pro-nle-NH2 is a fluorescent NK2 antagonist.</p>Formula:C56H65N13O11Colore e forma:SolidPeso molecolare:1096.2Bodilisant
CAS:<p>Bodilisant: nanomolar-affinity hH3R ligand, derived from piperidine, with BODIPY fluorophore.</p>Formula:C27H34BF2N3OColore e forma:SolidPeso molecolare:465.4Gulgafafusp alfa
CAS:<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Colore e forma:Liquid[D-Trp8]-γ-MSH
CAS:<p>[D-Trp8]-γ-MSH is a selective melanocortin 3 (MC3) receptor agonist (IC50 values are 6.7, 340 and 600 nM for human MC3, MC5 and MC4 receptors respectively).</p>Formula:C74H99N21O16SPurezza:98%Colore e forma:SolidPeso molecolare:1570.79Bertilimumab
CAS:<p>Bertilimumab (CAT 213; iCo-008), a human monoclonal antibody that targets eotaxin-1 (CCL11), shows promise in the research of allergic disorders [1].</p>Colore e forma:LiquidGUB03385
<p>GUB03385 is a long-acting PrRP31 analogue and an effective dual agonist for GPR10 (full agonist, EC50: 0.4 nM) and NPFF2R (partial agonist, EC50: 20 nM), with anti-obesity properties.</p>Formula:C198H322N60O52SPeso molecolare:4404.41173Myristoylated ARF6 (2-13)
<p>Myristoylated ARF6 (2-13) inhibits the MyD88–ARNO–ARF6 signaling axis by inactivating ARF6.</p>Formula:C74H128N16O18Peso molecolare:1528.95925γ1-MSH
CAS:<p>Endogenous melanocortin MC3 receptor agonist (pKi = 7.46) that displays ~ 40-fold selectivity over MC4.</p>Formula:C72H97N21O14SPurezza:98%Colore e forma:SolidPeso molecolare:1512.76Benzomalvin A
CAS:<p>Benzomalvin A is a filamentous fungal secondary metabolite.</p>Formula:C24H19N3O2Colore e forma:SolidPeso molecolare:381.43[Phe8Ψ(CH-NH)-Arg9]-Bradykinin
CAS:<p>Selective bradykinin B2 receptor agonist that is resistant to carboxypeptidase cleavage.</p>Formula:C50H75N15O10Purezza:98%Colore e forma:SolidPeso molecolare:1046.23Spantide II
CAS:<p>Spantide II is an antagonist of tachykinin.</p>Formula:C86H104Cl2N18O13Purezza:98%Colore e forma:SolidPeso molecolare:1668.77Vicasinabin
CAS:<p>Vicasinabin: potent CB2 agonist; researches chronic pain, atherosclerosis, bone mass, neuroinflammation.</p>Formula:C15H22N10OColore e forma:SolidPeso molecolare:358.41TAK-683 acetate
<p>TAK-683 acetate: potent KISS1R agonist (IC50=170 pM), stable, nonapeptide. Affects GnRH, FSH, LH, testosterone; potential in prostate cancer research.</p>Formula:C66H87N17O15Colore e forma:SolidPeso molecolare:1358.5CI-988 hemihydrate
<p>CI-988 hemihydrate (PD134308) is a potent and selective orally active CCK2R (cholecystokinin 2 receptor) antagonist, with an IC50 of 1.7 nM for mouse cortical CCK2. It is over 1600 times more selective for CCK2 than for CCK1 receptors. CI-988 hemihydrate exhibits anxiolytic and antitumor properties.</p>Formula:C35H42N4O6H2OPeso molecolare:632.321MR33317
<p>MR33317 is an inhibitor of acetylcholinesterase with an IC50 value of 41 nM. Additionally, it acts as an agonist for brain 5-HT4 receptors.</p>Formula:C22H28ClN3O2Peso molecolare:401.187Big Gastrin I (human) TFA
<p>BigGastrinI, human (TFA), is a gastrointestinal hormone comprised of 34 amino acids. It can serve as a potential substance in the study of conditions such as cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological disorders, or cardiovascular diseases.</p>Formula:C178H252F3Peso molecolare:2446.96712ARC 239 dihydrochloride
CAS:<p>ARC 239 dihydrochloride is a selective α2B adrenoceptor antagonist (pKD values are 8.8, 6.7 and 6.4 at α2B, α2A, and α2D receptors respectively).</p>Formula:C24H31Cl2N3O3Purezza:99.72%Colore e forma:SolidPeso molecolare:480.43[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Formula:C148H221N41O47SPurezza:98%Colore e forma:SolidPeso molecolare:3358.68Palmitoyl tetrapeptide-20 TFA
<p>Palmitoyl tetrapeptide-20 (PTP20) TFA is a biomimetic peptide and acts as an agonist of α-MSH. It protects follicular melanocytes by boosting catalase expression and activating melanogenesis.</p>Formula:C38H70N6O8·xC2HF3O2GLP-1(7-36), amide acetate
CAS:<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Formula:C151H230N40O47Purezza:99.89%Colore e forma:SolidPeso molecolare:3357.68GLP-1 receptor agonist 8
CAS:<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Formula:C34H36ClFN6O4Colore e forma:SolidPeso molecolare:647.14S1R agonist 1
CAS:<p>Compound 6b: Selective S1R agonist, K i = 0.93 nM (S1R), 72 nM (S2R); neuroprotective against ROS, NMDA toxicity.</p>Formula:C20H25NOColore e forma:SolidPeso molecolare:295.42Peptide C105Y TFA
<p>Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.</p>Formula:C97H148N20O23S·xC2HF3O2Oxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Formula:C192H295N59O60SPurezza:98%Colore e forma:SolidPeso molecolare:4421.86Cetirizine Impurity C
CAS:<p>Cetirizine Impurity C - a metabolite of hydroxyzine, is a long-acting, oral H1-antihistamine.</p>Formula:C21H25ClN2O3Colore e forma:SolidPeso molecolare:388.89SC 31391
CAS:<p>SC 31391 is a PGE1 analog.</p>Formula:C24H32O6Colore e forma:SolidPeso molecolare:416.51VVZ-149
<p>VVZ-149 is an antagonist of both serotonin receptor 2A (5HT2A) and glycine transporter type 2 (GlyT2), with potential anti-nociceptive activity.</p>Colore e forma:SolidCortistatin-14 acetate
<p>Cortistatin-14 acetate, a neuropeptide have structural similarity to somatostatin-14, binds and exerts its function via the somatostatin receptors (sst1-sst5).</p>Formula:C83H118N20O20S2Purezza:98.24% - 99.63%Colore e forma:SoildPeso molecolare:1780.08SGLT1/2-IN-2
CAS:<p>SGLT1/2-IN-2 is a chemical compound with robust dual inhibitory properties, exhibiting potent activities against SGLT1 (IC50 = 96 nM) and SGLT2 (IC50 = 1.3 nM).</p>Formula:C23H26F2O7Colore e forma:SolidPeso molecolare:452.451Rhazimine
CAS:<p>Rhazimine is an indole alkaloid. It is a dual inhibitor of arachidonic acid metabolism and platelet activating factor-induced platelet aggregation.</p>Formula:C21H22N2O3Colore e forma:SolidPeso molecolare:350.418BMS-604992 free base
CAS:<p>BMS-604992 (EX-1314), a selective GHSR agonist, binds strongly (ki=2.3 nM), is orally active, and increases rodent food intake.</p>Formula:C24H31N7O5Colore e forma:SolidPeso molecolare:497.556Israpafant
CAS:<p>Israpafant: PAF receptor blocker, IC50 0.84nM, hinders platelet aggregation, eosinophil activation, boosts calcium transit, anti-nephrotoxic.</p>Formula:C28H29ClN4SColore e forma:SolidPeso molecolare:489.07Alosetron-d3
CAS:<p>Alosetron D3 (GR 68755 D3) is a deuterium-labeled Alosetron. Alosetron is an antagonist of 5HT3-receptor.</p>Formula:C17H18N4OPurezza:98%Colore e forma:SolidPeso molecolare:297.37Conessine hydrobromide
CAS:<p>Conessine hydrobromide is a naturally occurring steroid alkaloid and has been used in traditional herbal medicine as a treatment for amoebic dysentery.</p>Formula:C24H41BrN2Colore e forma:SolidPeso molecolare:437.51PEN (rat)
CAS:<p>PEN (rat) is an Endogenous peptide GPR83 agonist. ProSAAS-derived neuropeptide.</p>Formula:C102H169N27O33Purezza:98%Colore e forma:SolidPeso molecolare:2301.62Bamosiran
CAS:<p>Bamosiran, a small interfering RNA (siRNA), specifically targets the β-adrenergic receptor 2 to reduce intraocular pressure.</p>Colore e forma:SolidCB2R/FAAH modulator-3
CAS:<p>CB2R/FAAH modulator-3 (compound 27) is a modulator targeting at CB2R and FAAH.</p>Formula:C22H31NO2Purezza:99.81%Colore e forma:SoildPeso molecolare:341.4920-SOLA
<p>20-SOLA is the first water-soluble 20-HETE antagonist with oral bioavailability. It significantly improves blood pressure changes and kidney damage associated with the streptozotocin (STZ) diabetic mouse model. Additionally, 20-SOLA acts as a GPR75 receptor blocker. This compound is useful in research related to cardiovascular pathology.</p>Formula:C33H62O9Peso molecolare:602.43938Tocrifluor T1117
CAS:<p>Fluorescent form of AM 251, CB1 receptor antagonist</p>Formula:C56H53Cl2N7O5Purezza:98%Colore e forma:SolidPeso molecolare:974.97MAO-B-IN-3
<p>MAO-B-IN-3 is a reversible, selective inhibitor of monoamine oxidase B (MAO-B) with an IC50 of 96 nM and demonstrates affinity for the 5-HT6 receptor with a Ki</p>Formula:C24H25N3O2Purezza:98%Colore e forma:SolidPeso molecolare:387.474-Butyl-α-agarofuran
CAS:<p>4-Butyl-alpha-agarofuran, a Gharu-wood derivative, is an anxiolytic, antidepressant, and aids neurological research.</p>Formula:C18H30OColore e forma:SolidPeso molecolare:262.43Mosapride citrate dihydrate
CAS:<p>Mosapride Citrate, a 5-HT4 agonist, boosts gut movement by enhancing acetylcholine release.</p>Formula:C27H35ClFN3O11Purezza:98%Colore e forma:SolidPeso molecolare:632.04Pasireotide
CAS:<p>Pasireotide (SOM 230) is a cyclohexapeptide, mimicking somatostatin with high affinity for sst1/2/3/4/5 receptors (pKi=8.2/9.0/9.1/<7.0/9.9).</p>Formula:C58H66N10O9Purezza:98%Colore e forma:SolidPeso molecolare:1047.21MK-0493 HCl
CAS:<p>MK-0493 is a novel, potent, and selective agonist for melanocortin receptor 4 (MC4R).</p>Formula:C30H39Cl2F2N3O2Colore e forma:SolidPeso molecolare:582.55Satavaptan
CAS:<p>Satavaptan is a vasopressin V2 receptor antagonist. Satavaptan improves the control of ascites in cirrhosis.</p>Formula:C33H45N3O8SColore e forma:SolidPeso molecolare:643.79Antibacterial agent 189
<p>Antibacterialagent 189 (compound 3a) is a potent antibacterial agent with high binding affinity to the target proteins OMPA/exo-1,3-β-glucanase. It demonstrates effective antibacterial activity against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Bacillus subtilis, Candida albicans, and Aspergillus flavus. Additionally, Antibacterialagent 189 exhibits strong binding affinity to the target proteins SMO and SUFU/GLI-1.</p>Formula:C37H28N4OPeso molecolare:544.22631Endolide F
<p>Endolide F (Compound 2) is a proline-containing lactone that serves as a moderate antagonist of the arginine vasopressin V1A receptor.</p>Formula:C25H32N4O6Peso molecolare:484.23218Pasireotide (diaspartate)
CAS:<p>Pasireotide diaspartate (SOM230) has high agonist activity at sst1/2/3/5, less at sst4; it's antiproliferative and proapoptotic.</p>Formula:C66H80N12O17Colore e forma:SolidPeso molecolare:1313.41Urocortin II, human TFA
<p>hUcn II, a CRF family member, targets CRF2 receptor, has time-linked stress regulation effects, showing mild motor suppression and delayed anxiolytic action.</p>Formula:C196H340F3N63O56SPurezza:98%Colore e forma:SolidPeso molecolare:4564.3ACTH (1-17)
CAS:<p>ACTH (1-17), a potent MC1 receptor agonist with a Ki of 0.21 nM, is a variant of corticotropin from the pituitary gland.</p>Formula:C95H145N29O23SPurezza:98%Colore e forma:SolidPeso molecolare:2093.41Galanin (1-29)(rat, mouse)
CAS:<p>Non-selective galanin agonist; Ki: GAL1-0.98, GAL2-1.48, GAL3-1.47 nM. Anticonvulsant, stops full seizures in rats.</p>Formula:C141H211N43O41Purezza:98%Colore e forma:White Lyophilized PowderPeso molecolare:3164.499FR252384
CAS:<p>FR252384 is an antagonist of the neuropeptide Y-Y5 receptor (IC50: 2.3 nM).</p>Formula:C18H17N3Purezza:98%Colore e forma:SolidPeso molecolare:275.35Neuropeptide Y (22-36)
CAS:<p>Neuropeptide Y (22-36) is a 15-amino acid fragment of NPY, which is abundant in the mammalian brain and involved in multiple physiological functions.</p>Formula:C85H139N29O21Purezza:98%Colore e forma:SolidPeso molecolare:1903.19[18F]-Labeled L-dopa precursor
CAS:<p>[18F]-Labeled L-dopa precursor is a precursor for synthesis of 18F-labeled L-dopa[1].</p>Formula:C35H36N2O7Colore e forma:SolidPeso molecolare:596.67Neuromedin N
CAS:<p>Neuromedin N is a neuropeptide derived from the same precursor polypeptide as neurotensin, and with similar but subtly distinct expression and effects.</p>Formula:C38H63N7O8Purezza:98%Colore e forma:SolidPeso molecolare:745.95Isobutyryl-L-carnitine
CAS:<p>Isobutyryl-L-carnitine is a member of the class of compounds known as acylcarnitines. Isobutyryl-L-carnitine is a product of the acyl-CoA dehydrogenases.</p>Formula:C11H21NO4Purezza:98%Colore e forma:SolidPeso molecolare:231.29Danshenol B
<p>Danshenol B is a natural product that can be used as a reference standard.</p>Formula:C22H26O4Colore e forma:SolidPeso molecolare:354.446MMC(TMZ)-TOC TFA
<p>MMC(TMZ)-TOC TFA exhibits high binding affinity and selectivity for the somatostatin receptor subtype 2 (SSTR2). It targets the delivery of TMZ to SSTR2-positive tumor cells, making MMC(TMZ)-TOC TFA useful for cancer research.</p>Formula:C74H99F3N20O21S2Colore e forma:SolidPeso molecolare:1725.8212-epi Leukotriene B4
CAS:<p>LTB4 is made enzymatically (12(R)-specific) and non-enzymatically (6-trans-12-epi mix). 12-epi LTB4 has low receptor activity.</p>Formula:C20H32O4Colore e forma:SolidPeso molecolare:336.472Antipsychotic agent-2
<p>Compound 11: potent antipsychotic, binds 5-HT1A/2A/2C, D2, H1 receptors; K is 56.6-1140 nM, BBB permeable.</p>Formula:C22H26FN5OColore e forma:SolidPeso molecolare:395.47Antisauvagine-30 TFA
<p>aSvg-30 TFA: potent CRF2 receptor antagonist, Kd 1.4 nM (mCRFR2β), 150 nM (CRFR1).</p>Formula:C163H275N48F3O49SColore e forma:SolidPeso molecolare:3764.28O-Desmethyl Mebeverine alcohol hydrochloride
CAS:<p>O-Desmethyl Mebeverine alcohol HCl, a metabolite of Mebeverine, is a strong α1 inhibitor, relaxing the GI tract.</p>Formula:C15H26ClNO2Colore e forma:SolidPeso molecolare:287.83Synephrine hemitartrate
CAS:<p>Synephrine hemitartrate, an alkaloid from Citrus aurantium, is a sympathomimetic for weight loss, with α and β-adrenergic action.</p>Formula:C9H13NO2C4H6O6Colore e forma:SolidPeso molecolare:242.26Exendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Formula:NAPurezza:98%Colore e forma:SolidPeso molecolare:3055.49Baloncibart
CAS:<p>Baloncibart is a human IgG4K monoclonal antibody that targets NPR1.</p>Colore e forma:LiquidVortioxetine D8
CAS:<p>Vortioxetine D8 is a deuterium-labeled antidepressant inhibiting 5-HT1A/B, 5-HT3A, 5-HT7 receptors & SERT (Ki: 15-1.6 nM).</p>Formula:C18H22N2SPurezza:98%Colore e forma:SolidPeso molecolare:306.5Adrenomedullin (16-31), human
CAS:<p>Adrenomedullin (16-31), human is amino acid residues 16-31 fragment of human adrenomedullin (hADM).</p>Formula:C82H129N25O21S2Purezza:98%Colore e forma:SolidPeso molecolare:1865.19NF 340
CAS:<p>P2Y11 antagonist</p>Formula:C37H30N4Na4O15S4Purezza:98%Colore e forma:SolidPeso molecolare:990.87Pentagastrin meglumine
CAS:<p>Pentagastrin meglumine is a synthetic pentapeptide that has effects like gastrin when given parenterally.</p>Formula:C44H66N8O14SColore e forma:SolidPeso molecolare:963.11GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Formula:C46H47FN8O7SColore e forma:SolidPeso molecolare:874.98GI-560192
CAS:<p>GI-560192 (RL-0070933), a potent smo modulator, EC50: 0.02µM; affects smoothened in cilia via hedgehog signaling.</p>Formula:C20H16N2O2Purezza:99.53%Colore e forma:SoildPeso molecolare:316.35Motilin, canine
CAS:<p>Motilin canine, a 22-amino acid peptide, functions as a robust gastrointestinal smooth muscle contraction agonist.</p>Formula:C120H194N36O34Purezza:98%Colore e forma:SolidPeso molecolare:2685.0513,14-dihydro-15-keto Prostaglandin F1α
CAS:<p>13,14-dihydro-15-keto Prostaglandin F1α (13,14-dihydro-15-keto PGF1α) is a metabolite of PGF1α that has been reported in the rat stomach.</p>Formula:C20H36O5Colore e forma:SolidPeso molecolare:356.5Neuropeptide Y(29-64)
CAS:<p>Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y.</p>Formula:C189H284N54O58SPurezza:98%Colore e forma:SolidPeso molecolare:4272.7MrgprX2 antagonist-2
CAS:<p>MrgprX2 antagonist-2, from patent WO2021092262A1 E163, is potent for skin inflammation studies.</p>Formula:C17H16F5N3O3Colore e forma:SolidPeso molecolare:405.325Heterobivalent ligand-1
<p>Heterobivalent ligand-1 targets A2A-D2 receptor heteromer with affinity: Kd for A2A=2.1 nM, D2=0.13 nM.</p>Formula:C86H115FN16O21Colore e forma:SolidPeso molecolare:1727.93Luseogliflozin
CAS:<p>Luseogliflozin inhibits SGLT2 for glucose uptake with 1.10 nM potency.</p>Formula:C23H30O6SColore e forma:SolidPeso molecolare:434.55Somatostatin 1-28 acetate
<p>Somatostatin 1-28 acetate circulates in human plasma.</p>Purezza:99.22%Colore e forma:SoildGLP-1R/GIPR agonist-1
<p>GLP-1R/GIPR agonist-1 is a dual receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide). It mimics the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while suppressing glucagon release, thus lowering blood sugar. This compound is used in research related to metabolic disorders such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH).</p>Formula:C220H342N55O69Peso molecolare:4858.49434S1H
<p>S1H is an analog of human growth hormone (hGH) and acts as an antagonist to the human growth hormone receptor (hGHR). It inhibits the interaction between hGH and hGHR and prevents the phosphorylation of STAT5 in cells treated with hGH.</p>Formula:C94H141N23O27Peso molecolare:2024.036735-HT1AR/5-HT6R ligand-1
<p>5-HT1AR/5-HT6R ligand-1 (Compound PP13) functions as a ligand for the 5-HT receptor, demonstrating high affinity for 5-HT1AR, 5-HT6R, and 5-HT7R with Ki values of 19, 69, and 198 nM, respectively. In HEK293 cells, it inhibits cAMP production with EC50 values of 1535, 488, and 53 nM for these receptors. Additionally, 5-HT1AR/5-HT6R ligand-1 exhibits antiproliferative effects on several cancer cell lines, including 1321N1, U87MG, MCF7, and AsPC-1, with IC50 values of 9.6, 13.6, 19.3, and 14.6 μM, respectively. The compound also shows antagonistic activity towards the dopamine receptor D2R, with a Ki of 1903 nM.</p>Formula:C25H29ClN4O2SColore e forma:SolidPeso molecolare:485.04NSC380324
<p>NSC380324 is a P2Y12 receptor antagonist with antiplatelet properties, which can be employed in research on atherosclerotic cardiovascular diseases.</p>Formula:C31H24N4O4Colore e forma:SolidPeso molecolare:516.55ELA-11(human)
CAS:<p>Apelin receptor agonist with high affinity (Ki = 14 nM). Blocks cAMP production and promotes β-arrestin activation; derived from ELA-32.</p>Formula:C58H90N16O13S2Purezza:98%Colore e forma:SolidPeso molecolare:1283.57Galantide
CAS:<p>Galantide is a reversible and non-specific antagonist of galanin receptor.</p>Formula:C104H151N25O26SPurezza:98%Colore e forma:White Lyophilised SolidPeso molecolare:2199.53Pexopiprant
CAS:<p>Pexopiprant, a potent oral antagonist of the prostaglandin D2 receptor 2 (DP2) with a K i value less than 100nM, is a valuable compound for asthma research.</p>Formula:C21H17Cl2F2NO4Colore e forma:SolidPeso molecolare:456.27SR142948A
CAS:<p>SR142948A is a selective and reversible non-peptide neurotensin receptor antagonist blocking hypothermia and analgesic effects, NMDA-induced dopamine release.</p>Formula:C39H52ClN5O6Purezza:98%Colore e forma:SolidPeso molecolare:722.31GLP-1R agonist 14
CAS:<p>GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].</p>Formula:C45H42F2N10O5Colore e forma:SolidPeso molecolare:840.88SSTR4 agonist-1
CAS:<p>SSTR4agonist-1 (Compound 47) is a selective agonist of the somatostatin receptor 4 (SSTR4), with an EC50 of 4.7 nM. It has a half-life of over 130 minutes in human liver microsomes.</p>Formula:C16H23N3O2Colore e forma:SolidPeso molecolare:289.37Adrenomedullin (AM) (22-52), human
CAS:<p>Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin.</p>Formula:C159H252N46O48Purezza:98%Colore e forma:SolidPeso molecolare:3576.04MGV354
<p>MGV354 is a soluble activator of guanylate cyclase(sGC) with EC 50 s of <0.5 nM, and 5 nM in CHO and GTM-3 E cells, respectively [1] [2].</p>Formula:C35H37N5O3Purezza:98%Colore e forma:SolidPeso molecolare:575.7Hemopressin (human, mouse)
CAS:<p>Endogenous peptide, inhibits ep24.15/24.16/ACE with Ki of 27.76/3.43/1.87 μM. Lowers blood pressure, CB1 inverse agonist, reduces pain in vivo.</p>Formula:C50H79N13O12Purezza:98%Colore e forma:SolidPeso molecolare:1054.26HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Formula:C20H31N7O9Purezza:98%Colore e forma:SolidPeso molecolare:513.5AMTG-DA1
<p>AMTG-DA1 is a ligand for the gastrin-releasing peptide receptor (GRPR), and it can be utilized in cancer research.</p>Formula:C101H149IN22O25Colore e forma:SolidPeso molecolare:2197.0109Tafluprost acid
CAS:<p>Tafluprost acid is a selective agonist at the prostaglandin F receptor.</p>Formula:C22H28F2O5Colore e forma:SolidPeso molecolare:410.46Ontazolast
CAS:<p>Ontazolast: a small-molecule LTB4R antagonist targeting asthma and immune disorders.</p>Formula:C21H25N3OPurezza:99.79%Colore e forma:SoildPeso molecolare:335.44PSB 0777 ammonium salt
CAS:<p>adenosine A2A receptor full agonist</p>Formula:C18H24N6O7S2Purezza:98%Colore e forma:SolidPeso molecolare:500.55SB656104
CAS:<p>SB656104 is a bioactive chemical.</p>Formula:C25H30ClN3O3SColore e forma:SolidPeso molecolare:488.04AR-C126313
CAS:<p>AR-C126313 is a thiouracil derivative.</p>Formula:C28H23N7O3SColore e forma:SolidPeso molecolare:537.59ACTH (11-24)
CAS:<p>ACTH (11-24) is an adrenocorticotrophin fragment, stimulates cortisol, and antagonizes ACTH (1-39)/(1-10) in adrenal cells.</p>Formula:C77H134N24O16Purezza:98%Colore e forma:SolidPeso molecolare:1652.04(R)-Preclamol hydrochloride
CAS:<p>(R)-Preclamol HCl is a dopamine agonist stimulating both auto and postsynaptic receptors.</p>Formula:C14H22ClNOColore e forma:SolidPeso molecolare:255.78(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Formula:C20H26ClF3N4O2Colore e forma:SolidPeso molecolare:446.895-HT7R antagonist 1 free base
CAS:<p>5-HT7R antagonist 1 (free base) is a G protein-biased antagonist for the 5-HT 7 R receptor, with a dissociation constant (K i) of 6.5 nM.</p>Formula:C14H17ClN4Colore e forma:SolidPeso molecolare:276.77Lys-[Des-Arg9]Bradykinin
CAS:Selective bradykinin B1 agonist with Ki 0.12 nM; inactive at B2 (>30,000 nM). Lowers blood pressure, more potent than Des-Arg9-Bradykinin.Formula:C50H73N13O11Purezza:98%Colore e forma:SolidPeso molecolare:1032.21Lys-[Des-Arg9]Bradykinin TFA
CAS:<p>Lys-[Des-Arg9]Bradykinin TFA: natural kinin, selective B1 agonist; Ki: 0.12 nM (human), 1.7 nM (mouse), 0.23 nM (rabbit); weak on B2 receptors.</p>Formula:C54H75F6N13O15Colore e forma:SolidPeso molecolare:1260.24Sarafotoxin S6a
CAS:<p>Endothelin receptor agonist (EC50 values are 7.5 and > 150 nM for contraction of pig coronary artery and guinea pig aorta respectively). Nociceptive in vivo.</p>Formula:C105H156N28O34S5Purezza:98%Colore e forma:SolidPeso molecolare:2514.85RFRP-3(human)
CAS:<p>NPFF1 receptor agonist, IC50 0.7 nM, blocks cAMP by forskolin. A GnIH homolog, it inhibits GnRH neuron activity.</p>Formula:C45H72N14O10Purezza:98%Colore e forma:SolidPeso molecolare:969.15Adrogolide HCl
CAS:<p>Adrogolide Hydrochloride is a selective dopamine receptor D1 agonist.</p>Formula:C22H26ClNO4SColore e forma:SolidPeso molecolare:435.96Urocortin II, mouse
CAS:<p>Mouse Urocortin II: Selective CRF2 agonist, Ki 0.66 nM for CRFR2, >100 nM for CRFR1, affects central neural circuits.</p>Formula:C187H320N56O50Colore e forma:SolidPeso molecolare:4152.96GLP-1 (9-36) amide
CAS:<p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>Formula:C140H214N36O43Purezza:97%Colore e forma:SolidPeso molecolare:3089.41HCGRP-(8-37)
CAS:<p>Rat CGRP-(8-37) (VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF) is a highly selective CGRP receptor antagonist</p>Formula:C139H230N44O38Purezza:98%Colore e forma:SolidPeso molecolare:3125.59Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Formula:C188H276N51F3O61Purezza:98%Colore e forma:SolidPeso molecolare:4283.5Parstatin(human) TFA
<p>Parstatin(human) TFA, a cell-penetrating PAR-1 thrombin receptor agonist peptide, effectively inhibits angiogenesis, as indicated by studies [1] [2].</p>Formula:C193H331F3N64O55S3Colore e forma:SolidPeso molecolare:4581.28APJ receptor agonist 1
CAS:<p>Potent APJ-R agonist 1, biphenyl acid, EC50: 0.093 nM (human), 0.12 nM (rat), targets apelin-13, promising for heart failure study.</p>Formula:C31H26ClN3O3Colore e forma:SolidPeso molecolare:524.02Hemopressin(rat)
CAS:<p>Peptide inhibitor for ep24.15, neurolysin & ACE with Ki 27.76, 3.43, 1.87 μM. Lowers blood pressure, modulates CB1 receptor, reduces pain & food intake.</p>Formula:C53H77N13O12Purezza:98%Colore e forma:SolidPeso molecolare:1088.27Cetirizine Impurity C dihydrochloride
CAS:<p>Cetirizine Impurity C dihydrochloride is a Cetirizine metabolite and long-acting H1-antihistamine.</p>Formula:C21H27Cl3N2O3Colore e forma:SolidPeso molecolare:461.81[8-L-arginine] deaminovasopressin
CAS:<p>[8-L-arginine] deaminovasopressin (dAVP) is a vasopressin analog [1] .</p>Formula:C46H64N14O13S2Colore e forma:SolidPeso molecolare:1085.22PAR 4 (1-6) (TFA)
<p>PAR 4 (1-6) TFA (GYPGQV TFA), a hexapeptide derived from protease-activated receptor 4 (PAR 4), serves as a specific agonist for PAR 4.</p>Formula:C28H41N7O9·xC2HF3O2Colore e forma:SolidClomipramine D3
CAS:<p>Clomipramine D3 is deuterium-labeled Clomipramine, blocking serotonin, norepinephrine, dopamine transporters (Ki: 0.14, 54, 3 nM).</p>Formula:C19H23ClN2Purezza:98%Colore e forma:SolidPeso molecolare:317.87L-770644
CAS:<p>L-770644 is an agonist of B3 adrenergic receptor.</p>Formula:C30H37N7O4SColore e forma:SolidPeso molecolare:591.72P4pal10 TFA
<p>P4pal10 TFA, the TFA salt form of P4pal10, serves as an antagonist of the protease-activated receptor 4 (PAR4). This compound inhibits platelet aggregation and thrombin generation induced by tissue factor (TF), exhibiting anticoagulant and antithrombotic activities. Additionally, P4pal10 TFA alleviates carrageenan-induced edema and neutrophil infiltration, and ameliorates damage in rat myocardial ischemia/reperfusion (I/R) models.</p>Colore e forma:Odour Solid
![[Sar9] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1862.webp&w=3840&q=75)
![[D-Trp8]-γ-MSH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1893.webp&w=3840&q=75)
![[Phe8Ψ(CH-NH)-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2076.webp&w=3840&q=75)
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
![[18F]-Labeled L-dopa precursor](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT74180.webp&w=3840&q=75)
![Lys-[Des-Arg9]Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1918.webp&w=3840&q=75)
![Lys-[Des-Arg9]Bradykinin TFA](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT73646.webp&w=3840&q=75)
![[8-L-arginine] deaminovasopressin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76573.webp&w=3840&q=75)
