Proteina G/GPCR
Gli inibitori dei GPCR/proteine G sono composti che bersagliano i recettori accoppiati alle proteine G (GPCR) e le proteine G associate, che svolgono ruoli critici nella trasmissione dei segnali dall'esterno all'interno delle cellule. Questi inibitori sono essenziali per studiare le vie di segnalazione mediate dai GPCR, coinvolte in numerosi processi fisiologici, tra cui la percezione sensoriale, la risposta immunitaria e la neurotrasmissione. Gli inibitori dei GPCR sono anche importanti nello sviluppo di farmaci, poiché molti agenti terapeutici prendono di mira questi recettori. Presso CymitQuimica, offriamo una vasta gamma di inibitori dei GPCR/proteine G di alta qualità per supportare le tue ricerche in farmacologia, biologia cellulare e campi correlati.
Sottocategorie di "Proteina G/GPCR"
- recettore 5-HT(993 prodotti)
- Recettore dell'adenosina(246 prodotti)
- Recettore adrenergico(3.004 prodotti)
- Recettore della bombesina(33 prodotti)
- Recettore della bradichinina(59 prodotti)
- CXCR(153 prodotti)
- CaSR(33 prodotti)
- Recettore dei cannabinoidi(212 prodotti)
- Recettore della dopamina(433 prodotti)
- Recettore dell'endotelina(79 prodotti)
- Recettore GNRH(77 prodotti)
- GPCR19(32 prodotti)
- GRK(32 prodotti)
- GTPase(22 prodotti)
- Recettore del glucagone(182 prodotti)
- Proteina Hedgehog/Smoothened(47 prodotti)
- Recettore dell'istamina(381 prodotti)
- Recettore LPA(21 prodotti)
- Recettore della melatonina(26 prodotti)
- Recettore OX(41 prodotti)
- Recettore degli oppioidi(310 prodotti)
- PAFR(12 prodotti)
- PKA(51 prodotti)
- Recettore S1P(18 prodotti)
- SGLT(31 prodotti)
- Recettore Sigma(46 prodotti)
Mostrare 18 più sottocategorie
Trovati 5745 prodotti di "Proteina G/GPCR"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
HDAC6-IN-49
<p>HDAC6-IN-49 (Compound 3) is an inhibitor of HDAC, with IC50 values of 0.012 and 0.735 µM against HDAC6 and HDAC1, respectively. Additionally, it inhibits MAO-B, cholinesterase (ChE), histamine receptor (H3R), and serotonin 6 receptor (5-HT6R). HDAC6-IN-49 exhibits neuroprotective effects in SH-SY5Y cells and enhances cognitive functions and motor abilities in fruit fly models of Parkinson's disease and C. elegans models of Alzheimer's disease.</p>Colore e forma:Odour SolidLU AA33810
CAS:<p>LU AA33810 is a neuropeptide Y (NPY) Y5 receptor antagonist.</p>Formula:C19H25N3O2S3Purezza:98%Colore e forma:SolidPeso molecolare:423.622-Methyl-N,N-dimethyltryptamine
CAS:<p>2-Methyl-N,N-dimethyltryptamine (2,N,N-TMT, compound 15) exhibits binding affinity for the serotonin (5-HT) receptor, with a pA2 value of 6.04. It plays a significant role in neurological disease research.</p>Formula:C13H18N2Colore e forma:SolidPeso molecolare:202.3Amylin (8-37), human
CAS:Human-derived Amylin (8-37) is a vasodilator in rat arteries and forms aggregates linked to type II diabetes.Formula:C138H216N42O45Colore e forma:SolidPeso molecolare:3183.495TT-OAD2 free base
CAS:TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.Formula:C50H47Cl2N3O6Purezza:98%Colore e forma:SolidPeso molecolare:856.83Upidosin
CAS:<p>Upidosin (SB-216469), a uroselective α1 blocker: Ki α1a=0.34 nM, α1b=3.9 nM, α1d=1.5 nM, α2=33.3 nM.</p>Formula:C31H33N3O4Purezza:99.66%Colore e forma:SolidPeso molecolare:511.61Meluadrine tartrate
CAS:<p>Meluadrine tartrate is an endogenous metabolite.</p>Formula:C16H24ClNO8Purezza:98%Colore e forma:SolidPeso molecolare:393.82Seglitide
CAS:<p>Peptide agonist targets sst2/sst5 receptors. IC50/Kd: sst1 >1000, sst2 = 0.2-1.5, sst3 = 27-36, sst4 >127, sst5 = 0.06-23 nM.</p>Formula:C44H56N8O7Purezza:98%Colore e forma:SolidPeso molecolare:808.98P2Y6R antagonist 1
P2Y6R antagonist 1 (compound 5ab) is a selective, orally active antagonist of P2Y6R, featuring an IC50 value of 19.6 nM. This compound also exhibits anti-inflammatory properties.Colore e forma:Odour SolidSRA880 malonate
CAS:SRA880: non-peptide sst(1) antagonist, low affinity for other sst receptors, binds dopamine D4, boosts SRIF, antidepressant-like effects.Formula:C29H36N4O8Purezza:98%Colore e forma:SolidPeso molecolare:568.62SR-140603
CAS:<p>SR-140603, the less potent enantiomer of SR 140333, is used as the negative control.</p>Formula:C37H45Cl3N2O2Purezza:98%Colore e forma:SolidPeso molecolare:656.12A71378
CAS:A71378 is a high potency, selectivity CCK-A receptors agonist.Formula:C48H62N8O13SPurezza:98%Colore e forma:SolidPeso molecolare:991.12Dulaglutide
CAS:<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Colore e forma:Solid(R,R)-Palonosetron Hydrochloride
CAS:(R,R)-Palonosetron Hydrochloride is the active enantiomer of PalonosetronFormula:C19H25ClN2OPurezza:98%Colore e forma:SolidPeso molecolare:332.87Pramlintide
CAS:<p>Pramlintide, a polypeptide analog of human amylin, is an antidiabetic agent with antineoplastic properties in colorectal cancer.</p>Colore e forma:SolidCCZ01048 TFA
CCZ01048 TFA, α-MSH analog, binds MC1R with 0.31 nM affinity, internalizes in melanoma cells, and is stable for melanoma PET imaging.Formula:C73H106F3N21O18Colore e forma:SolidPeso molecolare:1622.75RF9 acetate
RF9 acetate is an effective and selective antagonist of Neuropeptide FF receptor with Ki values of 58 and 75 nM for hNPFF1R and hNPFF2R, respectively.Formula:C28H42N6O5Purezza:99.77%Colore e forma:SolidPeso molecolare:542.67Bradykinin (1-3)
CAS:<p>Bradykinin (1-3) is a fragment of Bradykinin. Bradykinin is an activates pain receptors.</p>Formula:C16H28N6O4Purezza:98%Colore e forma:SolidPeso molecolare:368.43PAR-4 Agonist Peptide, amide
CAS:PAR-4 Agonist Peptide, amide (AY-NH2) is an agonist of proteinase-activated receptor-4 (PAR-4).Formula:C34H48N8O7Purezza:98%Colore e forma:SolidPeso molecolare:680.797-Hydroxy-PIPAT maleate
CAS:7-Hydroxy-PIPAT maleate is a D3R agonist.Formula:C16H22INOColore e forma:SolidPeso molecolare:371.262[Phe8Ψ(CH-NH)-Arg9]-Bradykinin
CAS:Selective bradykinin B2 receptor agonist that is resistant to carboxypeptidase cleavage.Formula:C50H75N15O10Purezza:98%Colore e forma:SolidPeso molecolare:1046.235-HT7R antagonist 1 free base
CAS:5-HT7R antagonist 1 (free base) is a G protein-biased antagonist for the 5-HT 7 R receptor, with a dissociation constant (K i) of 6.5 nM.Formula:C14H17ClN4Colore e forma:SolidPeso molecolare:276.77(Ala13)-Apelin-13 TFA
<p>'(Ala13)-Apelin-13 TFA acts as a potent antagonist of the apelin receptors (APJ) and impedes gastric motility via the vagal cholinergic pathway [1].'</p>Formula:C63H107N23O16S·xC2HF3O2Colore e forma:SolidPeso molecolare:1474.73 (free acid)DOTA-JR11
CAS:<p>DOTA-JR11 is a somatostatin receptor 2 (SSTR2) antagonist that can be radiolabeled with 68Ga.</p>Formula:C74H98ClN19O21S2Colore e forma:SolidPeso molecolare:1689.27MK-7246 S enantiomer
MK-7246 S enantiomer is a potent and selective CRTH2 antagonist.Formula:C21H21FN2O4SPurezza:98%Colore e forma:SolidPeso molecolare:416.47Pasireotide L-aspartate salt
CAS:Pasireotide L-aspartate, a stable cyclohexapeptide, mimics somatostatin with high affinity for sst1/2/3/4/5 receptors (pKi=8.2/9.0/9.1/<7.0/9.9).Formula:C62H73N11O13Purezza:98%Colore e forma:SolidPeso molecolare:1180.33RWJ 676070
CAS:RWJ 676070 is an antagonist of vasopressin V1A/V2 receptor.Formula:C30H26ClFN2O5Colore e forma:SolidPeso molecolare:548.99I-BOP
CAS:I-BOP is an agonist (KD=0.61 nM) at the thromboxane A2 receptor (TP).Formula:C23H29IO5Colore e forma:SolidPeso molecolare:512.38415(S)-15-methyl Prostaglandin E2
CAS:15(S)-15-methyl PGE2: A stable PGE2 analog; strong antiulcer with double PGE2 affinity; excels PGE1 in uterine contraction.Formula:C21H34O5Colore e forma:SolidPeso molecolare:366.49Plecanatide acetate
CAS:Plecanatide acetate: GC-C receptor agonist, EC50=190 nM (T84 cells), anti-inflammatory in murine colitis.Formula:C67H108N18O28S4Purezza:98%Colore e forma:SolidPeso molecolare:1741.94Pancreatic polypeptide TFA
<p>Pancreatic polypeptide TFA acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.</p>Colore e forma:Odour SolidKisspeptin-10, rat
CAS:<p>Kisspeptin-10, rat is an Endogenous ligand for the rodent kisspeptin receptor (KISS1, GPR54).</p>Formula:C63H83N17O15Purezza:98%Colore e forma:SolidPeso molecolare:1318.44(+)-Cloprostenol
CAS:<p>(+)-Cloprostenol is a analogue of prostaglandin F2α (PGF2α), and is selective prostaglandin receptor agonistic.</p>Formula:C22H29ClO6Purezza:98%Colore e forma:SolidPeso molecolare:424.92Spns2-IN-2
<p>Spns2-IN-2 (compound 3a) is an inhibitor of SPNS2.</p>Formula:C22H30ClN3O2Colore e forma:SolidPeso molecolare:403.95PF-4348235 HCl
<p>PF-4348235 HCl (β2AR/M-receptor agonist-2 HCl) is a muscarinic M3 receptor antagonist (Ki: 0.73 nM) and β2 adrenergic receptor agonist (MABA, EC50: 3.7 nM). PF-4348235 HCl is also a bronchial BM213 acetate is a bronchodilator used to study cardiovascular and respiratory diseases such as chronic obstructive pulmonary disease (COPD).</p>Formula:C36H50Cl2N4O7SPurezza:98.81%Colore e forma:SolidPeso molecolare:753.78Fenoldopam
CAS:Fenoldopam is a selective D1-like dopamine receptor partial agonist (EC50 = 57 nM).Formula:C16H16ClNO3Purezza:98%Colore e forma:SolidPeso molecolare:305.76Besipirdine hydrochloride
CAS:<p>Besipirdine hydrochloride is a non-receptor-dependent cholinomimetic compound with cardiovascular activity that inhibits the uptake of biogenic amines.</p>Formula:C16H18ClN3Purezza:98.45%Colore e forma:SoildPeso molecolare:287.79Chemerin-9 (149-157) TFA
Chemerin-9 (149-157) TFA is a peptide located at positions 149-157 of chemerin-9, acting as a ChemR23/CMKLR1 agonist.Formula:C56H67F3N10O15Purezza:99.77%Colore e forma:SolidPeso molecolare:1177.18Sauvagine
CAS:CRF receptor agonist; Ki: 9.4 nM (hCRF-R1), 9.9 nM (rCRF-R2a), 3.8 nM (mCRF-R2b) for 125I-[D-Tyr1]astressin binding inhibition.Formula:C202H346N56O63SPurezza:98%Colore e forma:SolidPeso molecolare:4599.35Calcitonin (human)
CAS:<p>Endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.</p>Formula:C151H226N40O45S3Purezza:98%Colore e forma:White Lyophilized PowderPeso molecolare:3417.87BAY-6672 hydrochloride
CAS:BAY-6672 hydrochloride is a potent, selective antagonist of the human Prostaglandin F (FP) receptor, exhibiting an IC50 value of 11 nM.Formula:C26H28BrCl2N3O3Colore e forma:SolidPeso molecolare:581.33Fasitibant chloride hydrochloride
CAS:Fasitibant chloride( MEN16132) is an effective and selective non-peptide antagonist of kinin B2 receptor.Formula:C36H50Cl4N6O6SColore e forma:SolidPeso molecolare:836.7IRL-1620 acetate
IRL-1620 acetate is an effective and selective agonist of Endothelin B receptor (ETB) with a Ki of 16 pM which is more selective than ETA with a Ki of 19 μM.Formula:C88H121N17O29Purezza:96.64%Colore e forma:SolidPeso molecolare:1881NF157
CAS:<p>NF157, a selective P2Y11 antagonist with pKi 7.35, lowers MMP-3/MMP-13, aiding OA treatment; IC50s: P2Y11 463 nM, P2Y1 1811 μM, P2Y2 170 μM.</p>Formula:C49H28F2N6Na6O23S6Purezza:98%Colore e forma:SolidPeso molecolare:1437.1MCUF-651
CAS:<p>MCUF-651 is a guanylyl cyclase A receptor positive allosteric modulators, EC50=0.45 μM.</p>Formula:C17H22F2N4OSPurezza:99.83%Colore e forma:SoildPeso molecolare:368.44FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Colore e forma:SolidPeso molecolare:3692.15tcY-NH2
CAS:Selective PAR4 antagonist peptide. Inhibits endostatin release and platelet aggregation induced by thrombin.Formula:C40H49N7O7Purezza:98%Colore e forma:SolidPeso molecolare:739.87PACAP (1-38) free acid TFA
<p>PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin</p>Colore e forma:Odour Solid(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Formula:C20H26ClF3N4O2Colore e forma:SolidPeso molecolare:446.89Bremelanotide
CAS:<p>Bremelanotide is a synthetic peptide analog of alpha-MSH and is an agonist at melanocortin receptors including the MC3R and MC4R.</p>Formula:C50H68N14O10Purezza:98%Colore e forma:White PowderPeso molecolare:1025.16
![[Phe8Ψ(CH-NH)-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2076.webp&w=3840&q=75)
