Proteina G/GPCR
Gli inibitori dei GPCR/proteine G sono composti che bersagliano i recettori accoppiati alle proteine G (GPCR) e le proteine G associate, che svolgono ruoli critici nella trasmissione dei segnali dall'esterno all'interno delle cellule. Questi inibitori sono essenziali per studiare le vie di segnalazione mediate dai GPCR, coinvolte in numerosi processi fisiologici, tra cui la percezione sensoriale, la risposta immunitaria e la neurotrasmissione. Gli inibitori dei GPCR sono anche importanti nello sviluppo di farmaci, poiché molti agenti terapeutici prendono di mira questi recettori. Presso CymitQuimica, offriamo una vasta gamma di inibitori dei GPCR/proteine G di alta qualità per supportare le tue ricerche in farmacologia, biologia cellulare e campi correlati.
Sottocategorie di "Proteina G/GPCR"
- recettore 5-HT(942 prodotti)
- Recettore dell'adenosina(242 prodotti)
- Recettore adrenergico(2.949 prodotti)
- Recettore della bombesina(30 prodotti)
- Recettore della bradichinina(59 prodotti)
- CXCR(149 prodotti)
- CaSR(32 prodotti)
- Recettore dei cannabinoidi(195 prodotti)
- Recettore della dopamina(410 prodotti)
- Recettore dell'endotelina(75 prodotti)
- Recettore GNRH(73 prodotti)
- GPCR19(31 prodotti)
- GRK(32 prodotti)
- GTPase(21 prodotti)
- Recettore del glucagone(166 prodotti)
- Proteina Hedgehog/Smoothened(45 prodotti)
- Recettore dell'istamina(359 prodotti)
- Recettore LPA(21 prodotti)
- Recettore della melatonina(24 prodotti)
- Recettore OX(40 prodotti)
- Recettore degli oppioidi(298 prodotti)
- PAFR(11 prodotti)
- PKA(49 prodotti)
- Recettore S1P(17 prodotti)
- SGLT(30 prodotti)
- Recettore Sigma(46 prodotti)
Mostrare 18 più sottocategorie
Trovati 5378 prodotti di "Proteina G/GPCR"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
19(R)-HETE
CAS:19(R)-HETE is a renal artery vasodilator and can be used to study angiotensin II-induced cardiac hypertrophy.Formula:C20H32O3Colore e forma:SolidPeso molecolare:320.47Neuronostatin-13 (human)
CAS:<p>Neuronostatin-13: human-conserved, 13-amino-acid peptide with amidated C-terminus.</p>Formula:C64H110N20O16Purezza:98%Colore e forma:SolidPeso molecolare:1415.68BMS-604992 free base
CAS:<p>BMS-604992 (EX-1314), a selective GHSR agonist, binds strongly (ki=2.3 nM), is orally active, and increases rodent food intake.</p>Formula:C24H31N7O5Colore e forma:SolidPeso molecolare:497.556HTR2A antagonist 1
<p>HTR2A antagonist 1 (Compound 15f) is an HTR2A antagonist with an IC50 of 42.79 nM. It induces sub-G1 cell cycle arrest and apoptosis in colorectal cancer cells by activating the p53/p21/caspase 3 signaling pathway. HTR2A antagonist 1 exhibits good liver microsomal stability and is useful for colorectal cancer research.</p>Formula:C35H43Cl2F2N5O4Colore e forma:SolidPeso molecolare:706.65Physalaemin
CAS:<p>Physalaemin is a non-mammalian tachykinin.</p>Formula:C58H84N14O16SPurezza:98%Colore e forma:SolidPeso molecolare:1265.45Prolactin Releasing Peptide (1-31), human
CAS:<p>Human Prolactin Releasing Peptide (1-31) is a potent GPR10 agonist; Ki values are 1.03 nM (human) and 0.33 nM (rat).</p>Formula:C160H252N56O42SPurezza:98%Colore e forma:SolidPeso molecolare:3664.15(R)-CJ 11974
CAS:<p>(R)-CJ 11974: non-peptide NK1 receptor antagonist, may relieve pain and prevent chemo-induced vomiting.</p>Formula:C31H38N2OPurezza:97.15%Colore e forma:SoildPeso molecolare:454.65S 16474
CAS:S 16474 is an antagonist of Neurokinin-1 Receptor.Formula:C44H48N6NaO8Purezza:98%Colore e forma:SolidPeso molecolare:811.892d[Leu4,Lys8]-VP acetate
<p>d[Leu4,Lys8]-VP acetate: Vasopressin V1b agonist. Ki: rat 0.16 nM, human 0.52 nM, mouse 1.38 nM. Low antidiuretic/vasopressor effects.</p>Formula:C49H71N11O13S2Purezza:98.86%Colore e forma:SolidPeso molecolare:1086.28HCGRP-(8-37)
CAS:Rat CGRP-(8-37) (VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF) is a highly selective CGRP receptor antagonistFormula:C139H230N44O38Purezza:98%Colore e forma:SolidPeso molecolare:3125.59Levocarnitine propionate hydrochloride
CAS:<p>Levocarnitine propionate hydrochloride (ST-261) is used for the treatment of the deterioration of renal function, congestive heart failure, and other diseases.</p>Formula:C10H20ClNO4Purezza:90% - 99.77%Colore e forma:SolidPeso molecolare:253.72Adrenomedullin (AM) (22-52), human
CAS:<p>Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin.</p>Formula:C159H252N46O48Purezza:98%Colore e forma:SolidPeso molecolare:3576.04Formoterol O-β-D-Glucuronide
CAS:<p>Formoterol O-β-D-glucuronide is a metabolite of formoterol .</p>Formula:C25H32N2O10Colore e forma:SolidPeso molecolare:520.535cAC 253 acetate
<p>cAC 253 acetate (TP2135 Free base) is an amylin antagonist. cAC 253 acetate inhibits 125I-adrenomedullin binding, with an IC50 of 25 nM.</p>Formula:C128H206N42O42S2Purezza:98.16% - 99.99%Colore e forma:SoildPeso molecolare:3069.39Poly-D-lysine hydrobromide (MW 1000-5000)
<p>Poly-D-lysine hydrobromide (PDLHB) (MW 1000-5000) is a synthetically produced polymeric substrate widely used in neural cell culture. Additionally, Poly-D-lysine hydrobromide acts as a CaSR agonist peptide.</p>Colore e forma:Odour SolidAzirkitug
<p>Azirkitug is a humanized IgG1κ antibody targeting CCR8, with HumanIgG1kappa, Isotype Control serving as its corresponding isotype control.</p>Colore e forma:Odour LiquidN-0500 HCl
CAS:<p>N-0500 HCl, a potent DA receptor agonist, displaces [3H]DP_x005f_x0002_5,6-ADTN with an IC50 of 3nM.</p>Formula:C15H22ClNO2Purezza:98.85% - 99.54%Colore e forma:SolidPeso molecolare:283.79[Des-Arg9]-Bradykinin acetate
CAS:<p>[Des-Arg9]-Bradykinin acetate is a selective agonist of Bradykinin B1 receptor.</p>Formula:C46H65N11O12Purezza:99.05%Colore e forma:SolidPeso molecolare:964.07CGRP antagonist 6
<p>CGRP Antagonist 6 (Compound 23) is a potent CGRP receptor antagonist (Ki: 0.84 nM). It is utilized in the study of migraines.</p>Colore e forma:Odour SolidBodilisant
CAS:<p>Bodilisant: nanomolar-affinity hH3R ligand, derived from piperidine, with BODIPY fluorophore.</p>Formula:C27H34BF2N3OColore e forma:SolidPeso molecolare:465.4(R)-Preclamol hydrochloride
CAS:<p>(R)-Preclamol HCl is a dopamine agonist stimulating both auto and postsynaptic receptors.</p>Formula:C14H22ClNOColore e forma:SolidPeso molecolare:255.78Dotanoc
CAS:<p>Dotanoc is a ligand to make gallium Ga 68-DOTANOC, which is a gallium Ga 68-radiolabeled analog of somatostatin.</p>Formula:C69H94N14O17S2Colore e forma:SolidPeso molecolare:1455.71HL2-m5
CAS:HL2-m5 is an inhibitor of the sonic hedgehog/patched (Shh/PTCH1) interaction, with a Kd for Shh of 170 nM. It effectively inhibits the activation of the Hedgehog signaling pathway and the transcription of Gli-controlled genes, with an IC50 of 230 nM.Formula:C70H101N15O24S3Colore e forma:SolidPeso molecolare:1632.83Glucagon (19-29), human
CAS:Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.Formula:C61H89N15O18SPurezza:98%Colore e forma:SolidPeso molecolare:1352.53DOAM
CAS:<p>DOAM is an antagonist of the 5-HT2 receptor.</p>Formula:C16H27NO2Colore e forma:SolidPeso molecolare:265.39Tau conotoxin CnVA
CAS:<p>Tau conotoxin CnVA, a small peptide found in the venom of Conus consors (cone snail), is a member of the T1 cone snail peptide superfamily. It demonstrates high selectivity for the somatostatin sst3 receptor with a Ki value of 1.5 µM. Tau conotoxin CnVA is unique as the only known toxin interacting with this subfamily of G protein-coupled receptors (GPCR). This compound is useful for research related to diseases associated with the sst3 receptor, such as pancreatic cancer or pituitary adenomas.</p>Formula:C72H116N24O17S4Colore e forma:SolidPeso molecolare:1718.1[8-L-arginine] deaminovasopressin
CAS:<p>[8-L-arginine] deaminovasopressin (dAVP) is a vasopressin analog [1] .</p>Formula:C46H64N14O13S2Colore e forma:SolidPeso molecolare:1085.22AC-263093
CAS:<p>AC-263093 is an NPFFR2 agonist with anxiolytic activity that increases c-Fos protein expression in the paraventricular nucleus of the hypothalamus.</p>Formula:C8H8Br2N4Purezza:99.78%Colore e forma:SoildPeso molecolare:319.98Orexin A (human, rat, mouse)
CAS:Orexin A, a 33 AA neuropeptide in humans, rats, mice, influences various processes, studied in pancreatic function and as an OX1R antagonist.Formula:C152H243N47O44S4Purezza:98%Colore e forma:SolidPeso molecolare:3561.1Uroguanylin (human) TFA
<p>Uroguanylin (human) (TFA) is the natural ligand for the guanylate cyclase C (GCC) receptor expressed in metastatic colorectal cancer tumors. In animal models of human colon cancer, Uroguanylin (human) (TFA) demonstrates antitumor activity.</p>Colore e forma:Odour SolidKisspeptin-54(human)
CAS:Endogenous ligand for KISS1 receptor; Ki values: rat 1.80 nM, human 1.45 nM. Inhibits tumor spread, stimulates gonadotropin release.Formula:C258H401N79O78Purezza:98%Colore e forma:SolidPeso molecolare:5857.49APJ receptor agonist 1
CAS:<p>Potent APJ-R agonist 1, biphenyl acid, EC50: 0.093 nM (human), 0.12 nM (rat), targets apelin-13, promising for heart failure study.</p>Formula:C31H26ClN3O3Colore e forma:SolidPeso molecolare:524.02TAK-683 acetate
<p>TAK-683 acetate: potent KISS1R agonist (IC50=170 pM), stable, nonapeptide. Affects GnRH, FSH, LH, testosterone; potential in prostate cancer research.</p>Formula:C66H87N17O15Colore e forma:SolidPeso molecolare:1358.5γ-1-Melanocyte Stimulating Hormone (MSH), amide
<p>γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and blood</p>Formula:C72H97N21O14SColore e forma:SolidPeso molecolare:1512.9Dolcanatide
CAS:Dolcanatide: oral GC-C agonist with laxative, pain-relief, and anti-inflammatory properties for IBD research.Formula:C65H104N18O26S4Colore e forma:SolidPeso molecolare:1681.89Scyliorhinin II
CAS:Scyliorhinin II, a cyclic Tachykinin peptide, is a potent NK3 receptor agonist.Formula:C77H119N21O26S3Purezza:98%Colore e forma:SolidPeso molecolare:1851.095-HT2C agonist-4
CAS:<p>Compound 3i, a 5-HT2C agonist-4, acts as an agonist for the 5-HT2C receptor with an EC50 of 5.7 nM. It is capable of reducing locomotor activity in zebrafish larvae.</p>Formula:C24H25N5OColore e forma:SolidPeso molecolare:399.49Halometasone
CAS:<p>Halometasone: synthetic corticosteroid for psoriasis and eczema treatment.</p>Formula:C22H27ClF2O5Colore e forma:SolidPeso molecolare:444.9(R)-Zevaquenabant
<p>(R)-Zevaquenabant ((R)-MRI-1867) is the enantiomer of Zevaquenabant. Zevaquenabant ((S)-MRI-1867) is a peripherally restricted, orally bioavailable dual antagonist of the cannabinoid CB1 receptor and inducible nitric oxide synthase (iNOS). It is beneficial in improving chronic kidney disease (CKD) caused by obesity.</p>Colore e forma:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Colore e forma:SolidPeso molecolare:3692.15Phenoxybenzamine
CAS:<p>Phenoxybenzamine blocks α-1 receptors, potentially reducing neuroinflammation post brain trauma.</p>Formula:C18H22ClNOPurezza:98%Colore e forma:Crystals From Petroleum Ether SolidPeso molecolare:303.83Guanylate cyclase-IN-1
CAS:<p>Guanylate cyclase-IN-1 (Example 46) is a specific inhibitor of guanylate cyclase, employed in research related to cardiovascular diseases.</p>Formula:C20H17FN8OColore e forma:SolidPeso molecolare:404.409Succinate/succinate receptor antagonist 1
CAS:<p>Potent succinate receptor antagonist with IC50 of 20 μM; blocks gingival succinate signaling, may treat periodontal disease.</p>Formula:C17H15N3OPurezza:99.53%Colore e forma:SoildPeso molecolare:277.32(Ala13)-Apelin-13 TFA
<p>'(Ala13)-Apelin-13 TFA acts as a potent antagonist of the apelin receptors (APJ) and impedes gastric motility via the vagal cholinergic pathway [1].'</p>Formula:C63H107N23O16S·xC2HF3O2Colore e forma:SolidPeso molecolare:1474.73 (free acid)M1145
CAS:<p>Potent GAL2 agonist with EC50 = 38 nM; Ki: 6.55 nM (GAL2), 497 nM (GAL3), 587 nM (GAL1); enhances galanin signaling.</p>Formula:C128H205N37O32Purezza:98%Colore e forma:SolidPeso molecolare:2774.26PAR-4 Agonist Peptide, amide
CAS:PAR-4 Agonist Peptide, amide (AY-NH2) is an agonist of proteinase-activated receptor-4 (PAR-4).Formula:C34H48N8O7Purezza:98%Colore e forma:SolidPeso molecolare:680.79Urocortin III (human)
CAS:<p>Urocortin III, a human peptide, binds CRF-R2, affecting insulin via somatostatin feedback with K i values 13.5-100+ nM.</p>Formula:C185H307N53O50S2Colore e forma:SolidPeso molecolare:4137.93SR 142948 dihydrochloride
<p>SR 142948 dihydrochloride is a selective oral non-peptide NT antagonist, IC50 <4 nM, with brain penetration and potential for psychiatric research.</p>Formula:C39H53Cl2N5O6Colore e forma:SolidPeso molecolare:758.77Setmelanotide Acetate(920014-72-8 free base)
CAS:<p>Setmelanotide Acetate(920014-72-8 free base) (RM-493 Acetate) is a selective agonist of melanocortin 4 receptor (MC4R)(human and rat MC4R with EC50s of 0.27 nM</p>Formula:C51H72N18O11S2Purezza:99.71%Colore e forma:SolidPeso molecolare:1177.35α-CGRP(human) TFA
<p>α-CGRP(human) TFA is a 37-amino acid regulatory neuropeptide that is extensively located within the central and peripheral nervous system, functioning as a</p>Formula:C165H268F3N51O51S2Colore e forma:SolidPeso molecolare:3903.33
![d[Leu4,Lys8]-VP acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1927L1.webp&w=3840&q=75)
![[Des-Arg9]-Bradykinin acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1445.webp&w=3840&q=75)
![[8-L-arginine] deaminovasopressin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76573.webp&w=3840&q=75)
