Acidi carbossilici

Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>

<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>

<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>

Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.

Prokineticin-2 is a protein that is encoded by the PROK2 gene. It has been shown to inhibit VEGF in vitro and to be anti-inflammatory. Prokineticin-2 binds to the receptor for colony stimulating factor 1 (CSF1) and promotes angiogenesis by inducing the production of angiogenic factors such as vascular endothelial growth factor (VEGF), erythropoietin, and granulocyte macrophage colony stimulating factor (GM-CSF). It also inhibits transcriptional regulation of genes involved in inflammation, including IL-10, which inhibits IL-12 production.

Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.

<p>3-Pyridylboronic acid pinacol ester is a versatile reagent that can be used in the synthesis of polymers with reactive functionalities. This compound is a crosslinker, which means that it reacts with two or more other molecules to form a covalent bond. 3-Pyridylboronic acid pinacol ester has been shown to react with ring-opening methacrylate monomers and expand their polymer backbone, which leads to an increase in the number of reactive groups on the chain. The introduction of 3-pyridylboronic acid pinacol ester can also introduce fluorescent units into polymers for use as probes for biological systems. There are many possible applications for this versatile reagent, including its use in the synthesis of imidazopyridine ligands.</p>

Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>

Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.

3-p-Coumaroylquinic acid is a natural compound found in plants. It has been shown to have antibacterial properties and can be used as an alternative to antibiotics for the treatment of opportunistic fungal infections. 3-p-Coumaroylquinic acid exhibits hypoglycemic activity, which may be due to its ability to inhibit glucose absorption by the gut. This compound can also be analyzed using a surface methodology that involves analyzing the surface of an object with a chemical reagent.

Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.

<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>

Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.

Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Intermediate in the synthesis of tedizolid

<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>

Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>

N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.

Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.

<p>Bz-Ile-Glu-Gly-Arg-pNA acetate salt is an anticoagulant that binds to heparin. It has been shown to inhibit protease activity in soybean trypsin by binding to the active site of the enzyme. Bz-Ile-Glu-Gly-Arg-pNA acetate salt has also been shown to have a molecular weight of heparin and a protein synthesis inhibition rate of fibrinogen, which is responsible for coagulation.</p>

<p>Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Please enquire for more information about Galanin-Like Peptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.

<p>Z-L-alpha-aminobutyric acid is a homogeneous, optically active, linear phosphinic analogue of alpha-aminobutyric acid. It has been used in the synthesis of phosphinic analogues of cyclosporin and undecapeptides with high yields. The coupling reaction between Z-L-alpha-aminobutyric acid and benzaldehyde was carried out in two steps to produce the desired product. A stepwise condensation between Z-L-alpha-aminobutyric acid and 3,4,5,6 tetrahydropyrimidine was also successful.</p>

Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.

Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

L-Glutamic acid alpha-amide is an ester hydrochloride that is a tissue culture amide. It is a cyclic peptide analog and a hydroxyl group. L-glutamic acid alpha-amide has been shown to inhibit the inflammatory response in the bowel disease, Crohn's disease, by blocking the toll-like receptor 4 and 5. This drug also inhibits protein synthesis, which may be due to its ability to bind to fatty acids, thereby inhibiting the production of proteins vital for cell division.

<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>

1-Adamantylphosphonic acid (1APA) is a trifluoroacetic acid derivative that is used as an organic solvent. It is also a catalyst in organic chemistry. 1APA can be used to catalyze the carbonylation of olefins with phosphines, which are ligands that bind to metal compounds and facilitate chemical reactions. Ferrocene, adamantyl, and metallocene are all examples of ligands. 1APA is also used as a reagent in the synthesis of phosphine ligands, which are used in catalytic reactions.

<p>2-(2-Naphthyloxy)propanoic acid is a naphthalene derivative that is found in the plant species Carthamus tinctorius. It has been shown to have potent antagonist activity against the NMDA receptor, as well as antinociceptive and analgesic properties in vivo. 2-(2-Naphthyloxy)propanoic acid also shows potent anti-inflammatory and cardioprotective effects in vitro and in vivo. 2-(2-Naphthyloxy)propanoic acid can be used for the treatment of bone cancer, congestive heart failure, diabetic neuropathy, or other disorders of the peripheral nervous system.</p>

Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.

(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.

<p>Bosentan is a potent inhibitor of the uptake of organic anions. It is used in the treatment of pulmonary arterial hypertension and has been shown to be effective against pravastatin-resistant HIV protease inhibitors, such as saquinavir, quinidine, and rosuvastatin. Bosentan inhibits uptake by binding to the transporter protein at a site that does not overlap with the binding site for organic anion substrates. This leads to a change in kinetic parameters for substrates, such as pravastatin and saquinavir. The binding site on bosentan may also be elucidated through monolayer experiments with efflux transporters.</p>

N-Methyliminodiacetic acid is a monosodium salt that is produced by the reaction of methylamine and malonic acid. It has been shown to have an inhibitory effect on enzymes and metabolic rates in the human body. The structure of N-methyliminodiacetic acid contains a hydroxyl group, which can form hydrogen bonding interactions with nitrogen atoms in proteins, forming a chelate ligand. This type of binding is thought to be responsible for its ability to inhibit enzyme activities and metabolic rate.

N-(2-Pyridyl)oxamic acid is a non-steroidal anti-inflammatory drug that belongs to the group of piroxicam. It was found to be a competitive inhibitor of the reaction between singlet oxygen and certain organic compounds. The reaction rate of N-(2-pyridyl)oxamic acid is dependent on the concentration of solvent, which affects the solvation of the reactants and products. The tautomerization equilibrium constant for N-(2-pyridyl)oxamic acid has been determined as 1.3 × 10 at 25°C in acetonitrile, with an apparent molecular weight of 251.6 g/mol. The singlet oxygen constant (Ks) for this compound is 2.8 × 10 at 25°C in acetonitrile, with a maximum absorbance wavelength at 295 nm and a half life time of 0.27 seconds at 298 K in pure water.

Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>

Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).</p>

<p>Please enquire for more information about Isopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.

<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is a versatile building block for the synthesis of complex compounds. It is used as a reagent to make other chemicals and has been used in the synthesis of research chemicals. 3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is also useful as an intermediate or scaffold compound in organic chemistry. This product has high purity and quality.

<p>TES, also known as N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid, is a buffering agent that is used in protein assays and forms complexes with DNA and copper ions. The optimal pH range of this zwitterionic buffer is 6.8-8.2 and its pKa is 7.4.</p>

<p>5,7-Docosadiynoic acid is a fluorescent molecule that has been found to have low molecular weight, which makes it ideal for use in a variety of strategies. This compound can be used as a fluorescent probe for the detection of membrane interactions and also has many potential applications in polymerized optical devices. 5,7-Docosadiynoic acid is able to fluoresce when irradiated with light at wavelengths above 500 nm and has been shown to be excited by UV light. The chemical properties of 5,7-docosadiynoic acid make it an excellent candidate for use in sensors and optical devices.</p>

<p>α-MSH (11-13) (free acid) acetate salt is a synthetic, nonsteroidal compound that binds to and activates α-melanocyte-stimulating hormone receptors. It has been used as an antiinflammatory agent in the treatment of inflammatory bowel disease and bowel disease. α-MSH (11-13) (free acid) acetate salt is also being studied as a contraceptive and an elastase inhibitor. This drug has shown some promise in the treatment of autoimmune diseases, such as rheumatoid arthritis, Crohn's disease, ulcerative colitis, multiple sclerosis, and type 1 diabetes mellitus. It is thought that α-MSH (11-13) (free acid) acetate salt may inhibit the production of inflammatory cells by inhibiting leukocyte elastase activity.</p>

LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)

<p>Glycodehydrocholic acid is a bile acid that is synthesized from cholesterol by the liver and intestine. It is used for the diagnosis of cancer and other medical conditions, such as obesity. Glycodehydrocholic acid inhibits the growth of adipose tissue cells, which may be due to its ability to increase the expression of genes related to lipid metabolism. This drug has also been shown to have an inhibitory effect on mitochondria and tumor cells in human serum. Glycodehydrocholic acid can be measured using chromatographic methods with a sample preparation before analysis. This drug can also be detected in urine samples by gas-liquid chromatography or mass spectrometry. The metabolic profiles of women differ from men, so it is important to take this into account when performing analytical chemistry procedures on this compound.</p>

<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Please enquire for more information about 5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page

C-type Natriuretic peptide is a peptide hormone that causes vasodilation, diuresis, and natriuresis. It is secreted by the heart and kidneys in response to volume overload. C-type Natriuretic peptide has been shown to cause fibrosis of the kidney as well as other tissues in mice. The binding of C-type Natriuretic peptide to its receptor activates cyclase, which converts ATP into cAMP. This leads to increased levels of cGMP, which causes smooth muscle relaxation and vasodilation.

Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.

<p>Fusidic acid is a hydrophilic antibiotic that is structurally related to penicillin. It has a cavity that interacts with γ-cyclodextrin, which can be used for its monitoring and stoichiometry. Fusidic acid has hydroxyl groups that are located on the 7th and 8th positions of the fusidate ring. This antibiotic has been shown to have stability constants in a range of 10-10 M. Fusidic acid also has two electrophoretically distinct forms, depending on the pH of the solution. The form at pH 10 is called fusidane, while the form at pH 5 is called fusidate.</p>

Please enquire for more information about tert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>4-Acetamidobenzenesulfonic acid (4ABS) is an organic compound that is used as a sulfa drug. It is found in the filtrate of the chemical reaction between inulin and sulfamic acid. 4ABS acts as an amine catalyst for acyl transfer reactions. 4ABS also reacts with chloroethanol to form a primary amino group on a colloidal particle surface. This reaction has been shown to be reversible, where hydrochloric acid can react with 4ABS to form the corresponding sulfamic acid.</p>

<p>2,4-Dihydroxybenzenesulfonic acid is a chemical compound that is used as a polymerization catalyst. It is most commonly used in the production of polyoxyethylene and copolymers. The catalytic activity of 2,4-dihydroxybenzenesulfonic acid is due to its acid group and hydroxy groups. This chemical can also be prepared by the reaction of resorcinol and hydrogen peroxide. The fluidity of this compound can be increased by adding an appropriate fluidizing agent such as peroxide or ammonium persulfate.</p>

<p>Please enquire for more information about Cromoglicic acid D5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sodium phenylacetate is a chemical compound that is used as an antifungal agent in vitro. It has also been shown to have anti-proliferative and cytotoxic effects on neuroblastoma cells. The physiological function of sodium phenylacetate is not well understood, but it may act as a neurotransmitter by inhibiting the release of acetylcholine or by regulating cell signaling pathways. Sodium phenylacetate may also inhibit angiogenesis, which would limit the growth of cancerous tumors.</p>

7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid (ABT) is a drug that binds to bacterial enzymes and inhibits their ability to synthesize proteins. ABT is a conjugate of fluoroquinolone and an amino acid. As the drug is degradable by hydrolysis, it has been shown to be less toxic in Sprague Dawley rats than other fluoroquinolones. This drug has been used in diagnostic tests as a ligand for affinity ligands, but has not been approved for human use. The drug also possesses functional groups that are important for binding to reconstituted enzymes.br>br>ABT's ester linkages are degradable by hydrolysis and can be

<p>Please enquire for more information about 3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-(-)-3-Phosphoglyceric acid disodium is a homologue of D-glyceric acid and is used in the synthesis of phosphatidylcholine. It binds to the active site of phosphatases and prevents them from hydrolyzing phosphate groups, which are critical for the production of adenosine triphosphate (ATP). The chemical stability and the availability make this compound an excellent candidate for biochemical studies. D-(-)-3-Phosphoglyceric acid disodium has been shown to be essential in biological function, as it functions as a substrate for many metabolic pathways such as glycolysis, gluconeogenesis, pentose phosphate pathway, and fatty acid biosynthesis. The molecule is also involved in a number of biochemical reactions that are catalyzed by enzymes. Mutational studies have shown that organisms without this compound will not survive.</p>

Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.

<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>

<p>Ethyl 4-formylpyrrole-2-carboxylate is a chemical compound that is used as an intermediate in organic synthesis. The compound has been reported to have spectra at m/z (M+1) of 168, 156 and 140. It also has been reported to have yields of about 98% when synthesized from ethyl azidoacetate and ethyl bromoacetate. The mass spectra show the molecular ion peak at m/z of 168, 156 and 140 corresponding to the structure of ethyl 4-formylpyrrole-2-carboxylate. Furan, n-substituted furan, thiophene, acetamide and cyclization are other possible structures for this molecule.</p>

Linolenic acid is a polyunsaturated fatty acid that is found in plants, animals, and human cells. Linolenic acid has been shown to suppress the growth of cancer cells by inhibiting the production of linoleic acid, which can stimulate the growth of cancer cells. Linolenic acid has also been shown to cause skin reactions such as erythema and pruritus when applied topically or taken orally. Linolenic acid may be used for the treatment of ovarian follicles. In addition, linolenic acid has been shown to have an allergic response in humans when it is injected into the vein. It is important to note that linolenic acid can inhibit T-cell proliferation and cytokine production in a dose-dependent manner. Furthermore, linolenic acid inhibits lipopolysaccharide-induced acute lung injury in mice by reducing inflammatory cell infiltration and neutrophil activation.

N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide is a molecule that has an optimum concentration of 0.5 M. It has a hydrogen bond donor and acceptor and is optically active. This molecule displays fluorescence properties and is inorganic with a chloride acceptor group. N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide has been shown to have high photostability and to be enhanced by light emission from a diode. This molecule also has carbonyl groups that are electron donors for the fluorescence process.

Please enquire for more information about Methyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Domoic acid is a neurotoxin that has been shown to induce neuronal death in vitro and in vivo. Domoic acid inhibits the activity of ligand-gated ion channels, which increases the cytosolic Ca2+ concentration. This toxin also induces mitochondrial membrane potential loss, causing apoptosis. Domoic acid binds to the NMDA receptor and blocks glutamate binding. It also inhibits ATP synthase by competing with ADP for binding sites on the enzyme's F1 portion. Domoic acid has low potency as a neurotoxin because it does not readily cross the blood-brain barrier or enter cells via passive diffusion.</p>

Kermesic acid is a hydroxybenzoic acid that is used as a food dye. It can be found in some red wines and it is also used to color the eggs of a particular breed of chicken. The most common use for kermesic acid is as an oxidizing agent in a chromatographic method, which separates molecules based on their size. The oxidation catalyst used can vary, but often trifluoroacetic acid (TFA) is used. TFA reacts with the kermesic acid to form an octaketide, which has the chemical formula C8H6O3. This octaketide then reacts with another molecule of TFA to form two esters.

Isatin-5-sulfonic acid sodium salt dihydrate is a potent inhibitor of caspases. It has been shown to inhibit the activity of caspase-3 in vitro, thereby inhibiting apoptosis. Isatin-5-sulfonic acid sodium salt dihydrate has also been shown to increase survival rates in animal models of neurodegenerative diseases such as Parkinson's disease and Huntington's disease. Isatin-5-sulfonic acid sodium salt dihydrate may have neuroprotective effects by inhibiting the release of proinflammatory cytokines and nitric oxide, which are associated with neuronal death. This drug also inhibits monoamine oxidase A (MAO-A) and zymosterone B (ZVAD).