Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
1-Myristoyl-rac-glycerol
CAS:1-Myristoyl-rac-glycerol is a fatty acid with a hydroxyl group and an antimicrobial effect. It has been shown to have clinical properties and is used in pharmaceutical preparations as an antimicrobial agent. 1-Myristoyl-rac-glycerol has been found to be active against gram negative bacteria such as E. coli, Pseudomonas aeruginosa, and Klebsiella pneumoniae, while being inactive against gram positive bacteria such as Staphylococcus aureus or Bacillus subtilis. The antimicrobial activity of this compound is due to its ability to disrupt the integrity of bacterial cell membranes by acting on lipid synthesis. 1-Myristoyl-rac-glycerol also has hemolytic activity and can cause death in fungi and yeast cells. 1-Myristoyl-rac-glycerol is not metabolized by humans but may be metabolized by microbes such as CandidaFormula:C17H34O4Purezza:Min. 95%Colore e forma:PowderPeso molecolare:302.45 g/molH-DCL-OH
Peptide H-DCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Lys(Boc)-OH
CAS:Fmoc-Lys(Boc)-OH is a monoclonal antibody that reacts with lysine residues. It is synthesized by reacting a solid phase support with an aliphatic hydrocarbon. The reactive functional group on the hydrocarbon terminates in an amine and forms an amide linkage to the amino terminus of the peptide. The hydroxyl terminus of the peptide is then reacted with a trifluoroacetic acid (TFA) ester of lysine in the presence of base. This reaction produces a TFA salt of Fmoc-Lys(Boc)-OH, which can be purified by high salt precipitation or reversed to produce Fmoc-Lys(Boc)-OH by treatment with base. Fmoc-Lys(Boc)-OH has been used as a reagent for chemical conjugation to fluorophores and other molecules such as biotin, avidin, streptFormula:C26H32N2O6Purezza:Min. 98.0 Area-%Peso molecolare:468.54 g/mol2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB
2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB is a resin that is used as a building block for peptide synthesis. It can be used to synthesize the building blocks for peptides, including amino acids, alcohols and amines. 2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB has been shown to react with thiols, alcohols and amines in solution to form covalent bonds. It can also be used as a tool in the synthesis of thiols, alcohols or amines.Purezza:Min. 95%H-KL-D-Leu-RLL-D-Lys-D-Lys-L-D-Leu-RL-D-Leu-LK-NH2
The H-KL-D-Leu-RLL-D-Lys-D-Lys-L-D-Leu-RL-D-Leu peptide is a peptide that has been shown to inhibit the growth of tumor cells. It binds to the tumor cell surface and inhibits cell proliferation. The H-KL peptide may also be useful as an antiinflammatory agent, as it has been shown to inhibit the production of prostaglandins in mice with arthritis.Formula:C90H174N26O15Purezza:Min. 95%Peso molecolare:1,860.56 g/molAc-Asp-pNA
CAS:Ac-Asp-pNA is a carboxy, serine protease that is used as an antigen in bactericidal and antibacterial assays. It also has been shown to be effective against neutral ph organisms such as E. coli and Pseudomonas aeruginosa. Ac-Asp-pNA elutes from the column when it is inactivated under neutral ph conditions, which can be seen by the presence of reactive peaks. The protonation of Ac-Asp-pNA at high pH results in a loss of reactivity, which can be detected by the diminazene peak at low pH. This protein is activated by potassium ions and cellular proteins, which can be seen by the presence of peaks at m/z 816 and 806 respectively.Formula:C12H13N3O6Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:295.25 g/mol3-Mercaptopropionyl-Phe-Cha-Cha-Arg-Lys-Pro-Asn-Asp-Lys-NH2
The peptide is a synthetic peptide that has been shown to have a binding affinity for the Protease-Activated Receptor 2 (PAR2). It is a PAR2 antagonist, and has been shown to reduce blood pressure in hypertensive rats. The peptide also inhibits the activity of thrombin, which may be due to its ability to inhibit the activation of PAR1.Formula:C61H100N16O13SPurezza:Min. 95%Peso molecolare:1,297.64 g/molH-His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH
Peptide H-His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecolare:1,521.76 g/molH-KDVLETFTVK^-OH
Peptide H-KDVLETFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 145
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,802.1 g/molH-LRRFSTAPF^AFIDINDVINF-NH2
Peptide H-LRRFSTAPF^AFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALAEHGIVFGEPK^-OH
Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVEPQLEDDER^-OH
Peptide H-AVEPQLEDDER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SLC12A8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC12A8 antibody, catalog no. 70R-6803Endothelin-2 (human, canine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C115H160N26O32S4Peso molecolare:2,546.97 g/molMatriptase Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Matriptase antibody, catalog no. 70R-12147Purezza:Min. 95%aiC15-RIIDLLWRVRRPQKPKFVTVWVR-OH
Peptide aiC15-RIIDLLWRVRRPQKPKFVTVWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-D-Met-OH
CAS:Boc-D-Met-OH is an amino acid building block that is used in the synthesis of peptides. It has been shown to have photophysical properties and specificities, as well as a helical structure. Boc-D-Met-OH has also been shown to react with anions, making it useful for peptide synthesis.Formula:C10H19NO4SPurezza:Min. 95%Peso molecolare:249.33 g/molAbz-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Gln-EDDnp
CAS:Abz-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Gln (EDDNP) is a novel and potent inhibitor of the polymerase chain reaction (PCR). It has been shown to inhibit the activity of DNA polymerases, which are key enzymes in DNA replication. EDDNP binds to the active site of the enzyme and blocks access to the DNA template. In addition, this compound inhibits mitochondrial membrane potential, as well as transcriptional regulation and detoxification enzymes. This compound has also been shown to be effective in vivo in mouse models.Formula:C61H91N21O19S2Purezza:Min. 95%Peso molecolare:1,486.66 g/molLCBiot-LRRFSTAPFAFIDINDVINF-NH2
Peptide LCBiot-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALFPGDSEIDQLFR^-OH
Peptide H-ALFPGDSEIDQLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYSTSVTGSR^-OH
Peptide H-VYSTSVTGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKTDHGAEIVYKSPVVSGDTSPR^-OH
Peptide H-AKTDHGAEIVYKSPVVSGDTSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CA-074 Me
CAS:CA-074 Me is a small molecule that binds to the receptor site of the ion channel. This binding triggers a conformational change in the ion channel, which leads to an influx of ions and an increase in membrane potential. CA-074 Me has also been shown to bind to peptide receptors and activate them, leading to similar effects on cell membranes as with ion channels. CA-074 Me is used for research purposes as it can be used as a tool for studying protein interactions and ligand-receptor binding. It is also often used as an antibody capture reagent. CA-074 Me is a research chemical that was synthesized by Hetero Drugs Limited (India) and has CAS No. 147859-80-1.END>Formula:C19H31N3O6Purezza:Min. 95%Peso molecolare:397.47 g/molOxyma Pure®
CAS:OxymaPure® is a hydrogen bond-based molecular probe that binds to the hydroxamic acid group of bacterial cell walls. It has been shown to have an antibacterial activity against Staphylococcus aureus and Escherichia coli. OxymaPure® is soluble in water, making it suitable for oral administration. The safety profile of OxymaPure® includes studies in rats, indicating that it does not cause any toxic effects at doses up to 2000 mg/kg body weight. OxymaPure® can be synthesized on a solid phase by using carbodiimides as reactive agents and linkers as additive materials. This process is relatively rapid and produces high yields of the desired product.Formula:C5H6N2O3Purezza:Min. 95%Peso molecolare:142.12 g/mol[Arg8]-Vasopressin (Human, Bovine, Ovine, Rat, Mouse) (0.5 mg vial)
CAS:Vasopressin is a hormone that is synthesized by the hypothalamus and secreted by the pituitary gland. Vasopressin is used in research to activate cells and study receptor-ligand interactions. It can be used to study ion channels, cell biology, and pharmacology. Vasopressin can be used as an inhibitor of peptides or proteins.Formula:C46H65N15O12S2Purezza:Min. 95%Peso molecolare:1,084.2 g/molH-THPHFVIPYR^-OH
Peptide H-THPHFVIPYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ITQSNAILR^-OH
Peptide H-ITQSNAILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tau Peptide (306-317) trifluoroacetate salt
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C65H109N15O18Peso molecolare:1,388.67 g/molH-Ala-Pro-Arg-Lys-Gln-Leu-Ala-Thr-Lys-Ala-Ala-Arg-Lys(Me3)-Ser-Ala-Pro-Ala-Thr-Gly-Gly-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C87H157N30O25Peso molecolare:2,023.38 g/molFormyl-Δ-toxin (1-26)
θ-toxin forms pores on the surface of host cells which can lead to cytolysis or activation of the inflammatory response. θ-toxin can induce mast cell degranulation. The toxin produced by S.aureus has been strongly linked to atopic dermatitis. As a natural antimicrobial it has been used as a template for novel and more potent antimicrobial peptides.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:3,006.56 g/molH-GAILSSTNVGSNTY-NH2
Peptide H-GAILSSTNVGSNTY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HIATNAVLFFGR^-OH
Peptide H-HIATNAVLFFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVNEVTEFAK^-OH
Peptide H-LVNEVTEFAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISTLNSHNLPILR^-OH
Peptide H-ISTLNSHNLPILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Trp63,Trp64)-C3a (63-77)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C86H134N26O18Peso molecolare:1,820.17 g/molSIVmac239 - 35
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,621.9 g/molSpike Omicron pool
Overlaping peptide library of Spike Omicron mutant. 15 amino acids per peptide with offset 11. Purity crude. All peptides are pooled in a single tube.pHLIP WT
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:4,525.87 g/molCMV pp65 pool
CMV pp65 is a pool of peptides which covers the complete sequence of the pp65 protein of human cytomegalovirus. It induces in vitro stimulation of antigen-specific CD4 and CD8 T cells.Ala-Gln-Tyr-Thr-Ser-Ala-Leu-Leu-Ala-Gly-Thr-Ile-Th
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C63H104N16O23Peso molecolare:1,453.59 g/molLCBiot-DAEFRHDSGYEVHHQ-OH
Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALPAPIEK^TISK-NH2
Peptide H-ALPAPIEK^TISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 27
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,699 g/molH-GADGVGK^SA-OH
Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVINASAAIAPK^-OH
Peptide H-SVINASAAIAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^R^-OH
Peptide H-R^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SL^YNTVATL-OH
Peptide H-SL^YNTVATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2
Peptide LCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-K^IADYNYKL-OH
Peptide H-K^IADYNYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TKEGVLYVGSK^-OH
Peptide H-TKEGVLYVGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LDPD-OH
Peptide LCBiot-LDPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLGSGAFGTVYK^-OH
Peptide H-VLGSGAFGTVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLFIIDGK^-OH
Peptide H-GLFIIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SAINNYAQKL-OH
Peptide H-SAINNYAQKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-Biot-CGKGRGLC-NH2
Peptide Cyc-Biot-CGKGRGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Leu-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Leu-Wang Resin is a research tool that can be used to synthesize peptides. It is used as an activator and ligand in the production of antibodies, ion channels, and cell biology. The resin has a high purity and can be used for a variety of purposes such as pharmacology, protein interactions, and peptide synthesis. Fmoc-Leu-Wang Resin has been shown to inhibit the binding of many different proteins to their receptors.Purezza:Min. 95%CMVpp65 - 107 (AMAGASTSAGRKRKS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,478.7 g/molBrazzein (1-54)
Brazzein (1-54) is a peptide that belongs to the group of activators. It has been shown to activate potassium channels, which are protein structures that allow potassium ions to pass through the membrane. Brazzein (1-54) also binds to and activates a number of receptors, including nicotinic acetylcholine receptor, serotonin receptor, and vanilloid receptor. This peptide has been shown to inhibit the activity of ion channels in cell culture studies. It has also been shown that brazzein (1-54) is an excellent antibody mimic.Purezza:Min. 95%SIVmac239 - 68
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,750.1 g/molH2N-Glu-Phe-Lys-His-Ile-Lys-Ala-Phe-Asp-Arg-Thr-Ph
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C139H208N36O36S2Peso molecolare:3,023.49 g/molCMVpp65 - 109 (AGRKRKSASSATACT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,494.7 g/molH-VSFEDSVISLSGDHSIIGR^-OH
Peptide H-VSFEDSVISLSGDHSIIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASGPGGGAPR^-OH
Peptide H-ASGPGGGAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclin-D2 Human Recombinant
Please enquire for more information about Cyclin-D2 Human Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurezza:>85% By Sds-Page.H-CDDRHDSGLDSMKDEE-NH2
Peptide H-CDDRHDSGLDSMKDEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^MFPNAPYL-OH
Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ara h1 (555-577) peanut allergen
Ara h 1 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 1 is a member of the 7/8 S globulin (vicilin) family of seed storage proteins belonging to the cupin superfamily and is the most abundant allergen present in the peanut kernel. Ara h 1 plays an important role in the allergy sensitising procedure and can be recognised by 90% of patients with a peanut allergy.This peptide represents a tryptic peptide of Ara h 1.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,375.7 g/molH-ALDNLAR^^-OH
Peptide H-ALDNLAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVLGQLGITK^-OH
Peptide H-SVLGQLGITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Arg-Phe-Lys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C27H47N9O5Peso molecolare:577.72 g/molH-NTLYLQMNSLR^-OH
Peptide H-NTLYLQMNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GADGVGKSAL^-OH
Peptide H-GADGVGKSAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CLDSPLPLRQRLKLRFQST-OH
Peptide Ac-CLDSPLPLRQRLKLRFQST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEIALSGK^-OH
Peptide H-TEIALSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FA-Phe-Gly-Gly-OH
CAS:FA-Phe-Gly-Gly-OH is a peptide with angiotensin II inhibitory properties. It has been shown that FA-Phe-Gly-Gly-OH inhibits the enzyme activity of angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II, which causes blood vessel constriction. The inhibitory effects of FA-Phe-Gly-Gly-OH on ACE are reversible and competitive, which is different from other ACE inhibitors that are irreversible and noncompetitive. This peptide also has antioxidative properties, due to its ability to scavenge reactive oxygen species (ROS). This peptide can be hydrolysed by esterases or proteases in vitro or in vivo.
Formula:C20H21N3O6Purezza:Min. 95%Colore e forma:White PowderPeso molecolare:399.4 g/molH-LPVDLAEELGHR^-OH
Peptide H-LPVDLAEELGHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclin-B1 Human Recombinant
Please enquire for more information about Cyclin-B1 Human Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurezza:>85% By Sds-Page.H-RLAVYQAGAR^-OH
Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGGFLGLSNIK^-OH
Peptide H-QGGFLGLSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo(-Leu-Trp)
CAS:Cyclo(-Leu-Trp) is a sweetener that has been used in the food industry for many years. Cyclo(-Leu-Trp) is able to bind with quinine and form a complex that can be detected using analytical methods. Cyclo(-Leu-Trp) has been investigated as a ligand that may be able to bind to receptors on cancer cells, which could lead to new treatments for cancer. Cyclo(-Leu-Trp) also has amphipathic properties and can form liposomes at high concentrations. This molecule has also been studied for its ability to induce transduction of DNA into bacterial cells and cellular thermogenesis.Formula:C17H21N3O2Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:299.37 g/molAc-RFAAKAA-OH
Peptide Ac-RFAAKAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTHFPICIFCCGCCHRSKCGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHRSKCGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DQFPEVYVPTVFENYVADIEVDGK^-OH
Peptide H-DQFPEVYVPTVFENYVADIEVDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIDTVLPNK^-OH
Peptide H-EIDTVLPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SEVAHR^-OH
Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.AF488 Plectin-1-targeting peptide
Plectin is a large protein found in nearly all mammalian cells and it acts as a link between the three main components of the cytoskeleton: actin microfilaments- microtubules and intermediate filaments. Plectin also links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. Therefore plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues.In cardiac muscle and skeletal muscle, plectin is localised to specialised entities known as Z-discs. Plectin binds several proteins including: vinculin, DES, actin, fodrin, microtubule-associating proteins, nuclear laminin B, SPTAN1, vimentin and ITGB4. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. Plectin has been proposed as a biomarker for pancreatic cancer. Alexa Fluor 488 dye is a bright, green-fluorescent dye with excitation maxima around 490 and emission maxima around 525. Alexa Fluor 488 dye is pH-insensitive over a wide molar range.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,857.7 g/molH-NVDLSTFYQNR^-OH
Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGFEDGSVLK^-OH
Peptide H-LGFEDGSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NDPTQQIPK^-OH
Peptide H-NDPTQQIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MBP (63-81)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,645.1 g/molH-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C194H295N55O57Peso molecolare:4,309.81 g/molAngiotensin I
CAS:The renin angiotensin system (RAS), consists of many angiotensin peptides involved in regulating functions such as blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and RAS is widely studied in relation to lifestyle-related diseases.Angiotensin I (Ang-I), is the first angiotensin to be produced upon activation of the RAS system. It is produced by the cleavage of angiotensinogen (AGT), catalysed by the aspartylprotease, renin. The dicarboxyl-peptidase angiotensin converting enzyme (ACE), then removes two amino acids from the C-terminus of Ang-I to form angiotensin II (Ang-II), and His-Leu.Ang-I is also converted to Ang-II by chymase, especially in the human heart. The chymase pathway is important in inflammatory conditions.Formula:C62H89N17O14Peso molecolare:1,296.48 g/molTrp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C68H100N18O21Peso molecolare:1,505.63 g/molH5N1 Labeled 5-peptide Mixture
Pack contains 100 vials. Peptide sequences:
H5N1 labeled seq1 H-IQIIPK^-OH H5N1 labeled seq2 H-LVLATGLR^-OHH5N1 labeled seq3 H-EFNNLER^-OH H5N1 labeled seq4 H-TLDFHDSNVK^-OHH5N1 labeled seq5 H-EEISGVK^-OH R^ = Arginine (U-13C6,15N4)K^ = Lysine (U-13C6,15N2)1nmol/peptide/vial and provided as dry aliquotsPurezza:Min 98%H-VVSVLTVLHQDWLNGKEY^K-OH
Peptide H-VVSVLTVLHQDWLNGKEY^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPDATPK^-OH
Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^PHFPQFSYSASGTA-OH
Peptide H-R^PHFPQFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Arg8]-Vasopressin (Human, Bovine, Ovine, Rat, Mouse) (0.5 mg vial)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPVP-4085-V.webp&w=3840&q=75)
