
Peptidi
Sottocategorie di "Peptidi"
Trovati 29863 prodotti di "Peptidi"
CCK-33 (Human)
CAS:CCK-33 is a synthetic peptide that is used as a research tool. It binds to the CCK2 receptor and activates it, triggering the release of the neurotransmitter acetylcholine. CCK-33 is also an inhibitor of voltage-gated potassium channels, which are important for neuronal communication. CCK-33 can be used to identify other ligands for this receptor, or as an antibody epitope tag in cell biology studies.Formula:C167H263N51O52S4Purezza:Min. 95%Peso molecolare:3,945.4 g/molm-dPEG®24-MAL
CAS:m-dPEG®24-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C22H39F3N4O7SPurezza:Min. 95%Peso molecolare:560.63 g/molPTH-rP (Human,1-34 Amide)
CAS:PTH-rP is a peptide that has been used as a research tool for the study of ion channels, protein interactions, and receptor signaling. It is an inhibitor of PTH/PTH-related protein receptor. PTH-rP is a ligand for the PTH/PTH-related protein receptor and can be used to identify novel receptors or ligands. This compound has been shown to have the ability to inhibit cellular proliferation and induce apoptosis in certain cell lines.Formula:C180H288N58O47Purezza:Min. 95%Peso molecolare:4,016.6 g/molMOCAc-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH₂
CAS:MOCAc-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg is a peptide with ion channel activity. It is a potent activator of potassium channels and has been used in research as a tool for studying ion channel function. MOCAc is not an inhibitor of voltage sensitive sodium channels but does inhibit calcium currents. MOCAc also has been shown to be a ligand for the nicotinic acetylcholine receptor and is able to bind to the beta subunit of this receptor. This peptide binds to the alpha subunit of the calcium channel, leading to inhibition of calcium currents and activation of potassium channels.
Formula:C85H122N22O19Purezza:Min. 95%Peso molecolare:1,756 g/molAzido-dPEG®36-Alcohol
CAS:Azido-dPEG®36-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®36-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Purezza:Min. 95%Peso molecolare:1,628.92 g/molAmino-dPEG®12-ODMT
CAS:Amino-dPEG®12-ODMT is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-ODMT is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C10H20O5Purezza:Min. 95%Peso molecolare:220.26 g/molGlucagon-like Peptide 1 (Human 7-37)
CAS:GLP-1 is a peptide hormone that is released by the pancreas in response to food intake. This hormone activates receptors on the L cells of the ileum and duodenum, which causes increased production of insulin and decreased production of glucagon. GLP-1 also decreases appetite, slows gastric emptying, and reduces blood glucose levels by increasing the uptake of glucose into muscle cells. GLP-1 has been shown to be effective in reducing body weight, lowering blood pressure and cholesterol levels, improving glycemic control, and preventing diabetes. The GLP-1 receptor is found in ion channels and cell biology as well as pharmacology.Formula:C151H228N40O47Purezza:Min. 95%Peso molecolare:3,355.7 g/molBz-Arg-AMC
CAS:Bz-Arg-AMC is a fluorescent probe that binds to the nicotinic acetylcholine receptor (nAChR) in the presence of calcium ions and emits light when excited by ultraviolet light. It can be used to study the activation of nAChRs, as well as their interactions with other proteins such as peptides. Bz-Arg-AMC has a molecular weight of 551.9 g/mol, with a purity of > 98% and an optical purity of > 99%. This product can be used for research purposes only, not for diagnostic or therapeutic purposes.
Formula:C23H25N5O4Purezza:Min. 95%Peso molecolare:435.48 g/molMet-Met
CAS:Met-Met is a dipeptide that is synthesized from the amino acids methionine and methyltetrahydrofolate. It is used in the synthesis of peptides and biochemicals, as well as in pharmacological treatments for diseases including bacterial infections. Met-Met has significant interactions with dopamine, catechol-o-methyltransferase, and energy metabolism. The enzyme catechol-o-methyltransferase catalyzes the conversion of dopamine to 3,4-dihydroxyphenylacetic acid (DOPAC), which may lead to a decrease in dopamine levels. Met-Met also inhibits the metabolism of catecholamines, leading to an increase in cellular levels of catecholamines such as dopamine and norepinephrine. This inhibition may be responsible for metabolic disorders such as obesity or low body mass index (BMI)
Formula:C10H20N2O3S2Purezza:Min. 95%Peso molecolare:280.41 g/molAzido-dPEG®4-NHS ester
CAS:Azido-dPEG®4-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C27H53N3O14Purezza:Min. 95%Peso molecolare:643.72 g/molBis-dPEG®9-PFP Ester
CAS:Bis-dPEG®9-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®9-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C34H40F10O13Purezza:Min. 95%Peso molecolare:846.66 g/molFibronectin Active Fragment (GRGDS)
CAS:Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.
The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.
The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.Formula:C17H30N8O9Purezza:Min. 95%Peso molecolare:490.47 g/mol(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu
CAS:(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu is a peptide that is an inhibitor of Protein interactions. It blocks the binding of the enzyme to its substrate and prevents the conversion of substrate to product. This peptide was used as a research tool for studying protein interactions in cell biology and as an activator for Ligands. This peptide can be used as a reagent for antibody production. The purity of this peptide is high and it has been shown to have no adverse effects in animal research studies.Formula:C23H26N2O4F2Purezza:Min. 95%Peso molecolare:432.46 g/molAmylin (Rat)
CAS:Prodotto controllatoAmylin is a peptide that belongs to the group of activators. It has been shown to be an inhibitor of ion channels, and has also been demonstrated to activate cell signaling pathways. Amylin can be used as a research tool for studying protein interactions, receptor ligands, and pharmacology. Amylin can be used in antibody production or as a high-purity reagent for life science or cell biology applications.
Formula:C167H272N52O53S2Purezza:Min. 95%Peso molecolare:3,920.4 g/molAdenylate Kinase 4, human, recombinant
Adenylate kinase 4 (AK4) is a protein that in humans is encoded by the AK4 gene. AK4 catalyzes the conversion of adenosine triphosphate (ATP) to adenosine monophosphate (AMP). The enzyme has been shown to play an important role in the regulation of cell proliferation and survival, as well as in the regulation of ion channels, neurotransmitter release, and other biological processes. AK4 is also an activator of G-protein coupled receptors and a ligand for certain nuclear receptors. It can also function as an inhibitory receptor for certain G-protein coupled receptors.Purezza:Min. 95%Bis-Maleimide Amine, TFA Salt
CAS:Bis-Maleimide Amine, TFA Salt is a pharmacological research tool that is used to study protein interactions. It is also used as an inhibitor and activator of proteins, specifically ion channels. This product has a CAS number of 62921-76-0, which can be found on the Chemical Abstracts Services website. This product is high purity and is used in life science research. The salt form of this product is used as a ligand for receptor binding studies.Formula:C16H26O7SPurezza:Min. 95%Peso molecolare:362.44 g/mol[D-Pro2,D-Trp7,9]-Substance P
CAS:This product is a Substance P antagonist and is available as a 0.5mg vial. Substance P is a neuropeptide that is involved in the transmission of pain signals and inflammation. It is a member of the tachykinin neuropeptide family and is produced in the central nervous system and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.
Formula:C74H106N20O13SPurezza:Min. 95%Peso molecolare:1,515.8 g/molCalcitonin (Human)
CAS:Calcitonin is a hormone produced by the C cells (also known as parafollicular cells) in the thyroid gland. Its main function is to regulate the levels of calcium and phosphate in the blood. Calcitonin works by inhibiting the activity of osteoclasts, which are cells that break down bone tissue and release calcium and phosphate into the bloodstream. This leads to a decrease in the amount of calcium and phosphate in the blood. Calcitonin is released in response to high levels of calcium in the blood, and it acts to reduce these levels by increasing the excretion of calcium by the kidneys and inhibiting the absorption of calcium by the intestines. It also promotes the storage of calcium in the bones, which helps to maintain their strength and density. Calcitonin may be used therapeutically to treat conditions such as osteoporosis and hypercalcemia (high levels of calcium in the blood) or even diagnostically as a marker for tumors in medullary thyroid cancer. This product has a disulfide bond between Cys1-Cys7 and is available as a 0.5mg vial.Formula:C151H226N40O45S3Purezza:Min. 95%Peso molecolare:3,417.8 g/molMAL-dPEG®11-Lipoamide
CAS:MAL-dPEG®11-Lipoamide is a PEG molecule conjugated with a lipid moiety. MAL-dPEG®11-Lipoamide, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.
Formula:C21H37N3O8SPurezza:(%) Min. 97%Peso molecolare:491.6 g/molAmastatin
CAS:Amastatin is a natural protease inhibitor that has been shown to bind to the active site of serine proteases, such as trypsin and chymotrypsin. It also binds to other peptide substrates, such as angiotensin II, vasopressin and bradykinin. Amastatin is used in research as a tool for the study of protein interactions, receptor-ligand binding and ion channel activity. Amastatin is an activator of the high-affinity state of the beta-adrenergic receptor.Formula:C21H38N4O8Purezza:Min. 95%Peso molecolare:474.55 g/molAc-Val-Glu-Ile-Asp-H (aldehyde)
CAS:Ac-Val-Glu-Ile-Asp-H (aldehyde) is a synthetic peptide that is used as an inhibitor to study the effects of protein interactions. Ac-Val-Glu-Ile-Asp-H (aldehyde) binds to the active site of the enzyme, which prevents the enzyme from functioning and can be used as a research tool. Ac-Val-Glu-Ile-Asp-H (aldehyde) has been shown to activate some receptors and ligands, such as ion channels and antibodies.Formula:C22H36N4O9Purezza:Min. 95%Peso molecolare:500.54 g/molZ-Gly-Phe-NH2
CAS:Z-Gly-Phe-NH2 is a peptide that inhibits protein synthesis by binding to the ribosome. It has been shown to inhibit enzyme preparations containing peptides and proteins, such as hydrogen bond formation, phase transition temperature, uptake, and inhibitory effect. This molecule may be used in biochemical or molecular studies of protein synthesis. The uptake of Z-Gly-Phe-NH2 can be inhibited by ouabain binding. Z-Gly-Phe-NH2 also has a ca2+ response when calcium ionophores are applied to Xenopus oocytes.
Formula:C19H20N2O5Purezza:Min. 95%Peso molecolare:355.39 g/molOrexin-B (Human)
CAS:Orexin B, also known as hypocretin-2, is a neuropeptide that is produced by a small group of neurons in the hypothalamus, a region of the brain that plays a critical role in regulating various physiological functions, including sleep, appetite, and energy balance. Orexin B plays a role in promoting wakefulness and arousal and studies have shown that disruptions in the orexin system are associated with various sleep disorders, including narcolepsy and insomnia. In addition, orexin B has been shown to be involved in the regulation of appetite and energy metabolism, and is being explored as a potential target for the treatment of obesity and other metabolic disorders. Therefore, orexin B is an important neuropeptide and is an active area of research in neuroscience and medicine. This product is available as a 0.1mg vialFormula:C123H212N44O35SPurezza:Min. 95%Peso molecolare:2,899.3 g/molNHS-dPEG®24-Biotin
CAS:NHS-dPEG®24-Biotin is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®24-Biotin is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C9H20O4SPurezza:Min. 95%Peso molecolare:224.32 g/molFibronectin Active Fragment (RGDS)
CAS:Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.
The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.
The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials.Formula:C15H27N7O8CH3COOH•2H2OPurezza:Min. 95%Peso molecolare:499.48 g/molUrotensin II (Human)
CAS:A potent vasoconstrictor, available in the hydrochloride form with disulfide bonds between Cys5-Cys10 and as a 0.5mg vial. Urotensin II (UT-II) is a peptide that is found in humans and other vertebrates and is involved in biological systems such as the nervous, endocrine, cardiovascular and renal. Like that of urotensin II-related peptide, urotensin II contains the hexapeptide -CYS-TYR-LYS-TRP-PHE-CYS- known as the core and this is crucial to its biological function. Urotensin II can also increase the concentration of intercellular calcium through binding to its G protein coupled receptor: urotensin-II receptor which causes the activation of Protein kinase C followed by the activation of Phospholipase C. UT-II is widely distributed throughout the body, with highest concentrations found in the cardiovascular system, particularly in the heart and blood vessels. UT-II has been shown to have a wide range of physiological effects in humans, including vasoconstriction, modulation of blood pressure, and stimulation of the release of aldosterone and vasopressin. In addition to its physiological effects, UT-II has also been implicated in the pathogenesis of various cardiovascular and metabolic disorders, including hypertension, heart failure, and diabetes. Inhibition of UT-II signaling has been suggested as a potential therapeutic target for these conditions.Formula:C64H85N13O18S2Purezza:Min. 95%Peso molecolare:1,388.6 g/molm-dPEG®36-Amine
CAS:m-dPEG®36-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®36-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C73H149NO36Purezza:Min. 95%Peso molecolare:1,616.95 g/molParathyroid Hormone (Human, 39-68)
CAS:Amino acids 39-68 of the Parathyroid Hormone (PTH) which is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 0.5mg vial.
Formula:C139H234N46O46Purezza:Min. 95%Peso molecolare:3,285.6 g/molNeuromedin S (Rat)
CAS:Neuromedin S (Rat) is a peptide that is a potent inhibitor of protein interactions. It binds to the extracellular domain of the receptor and blocks its interaction with the ligand. This can be used as a research tool for studying the role of proteins in cell biology, pharmacology, or ion channels. Neuromedin S (Rat) is a high-purity peptide with CAS No. 843782-19-4 that has been shown to inhibit ligand binding to receptors in vitro and in vivo. Neuromedin S (Rat) also inhibits agonist-induced activation of ion channels at micromolar concentrations and blocks voltage-gated sodium currents at nanomolar concentrations. It has been used to study the role of neurexins in transmission at synapses between neurons by blocking their interaction with neuroligins.Formula:C193H307N57O49SPurezza:Min. 95%Peso molecolare:4,241.9 g/molAdrenomedullin (Human, 22-52)
CAS:This product is an antagonist of adrenomedulin which is a vasodilator peptide hormone and also plays a role in the stimulation of angiogenesis which can be seen as a negative to human health as it helps tumors to extend their blood supply. This product is available as a 0.5mg vial.Formula:C159H252N46O48Purezza:Min. 95%Peso molecolare:3,576 g/molAzido-dPEG®12-acid
CAS:Azido-dPEG®12-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C73H147N3O36Purezza:Min. 95%Peso molecolare:1,642.95 g/molNHS-dPEG®4-Biotinidase Resistant Biotin
CAS:NHS-dPEG®4-Biotinidase Resistant Biotin is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4-Biotinidase Resistant Biotin is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C15H32N2O5Purezza:Min. 95%Peso molecolare:160.21 g/molm-dPEG®7-Tosylate
CAS:m-dPEG®7-Tosylate is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®7-Tosylate is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C27H45NO12Purezza:Min. 95%Peso molecolare:575.65 g/molBis-dPEG®25-NHS Ester
CAS:Bis-dPEG®25-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®25-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C62H112N2O33Purezza:Min. 95%Peso molecolare:1,413.55 g/molBiotin-dPEG®11-Lipoamide
CAS:Biotin-dPEG®11-Lipoamide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-Lipoamide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C42H78N4O14SPurezza:Min. 95%Peso molecolare:959.28 g/molß-Casomorphin-7 (Bovine)
CAS:β-Casomorphin-7 (Bovine) is an opioid peptide that belongs to the class of casomorphins. It is a fragment of the larger ß-casomorphin molecule, which is derived from the breakdown of proline-rich proteins in cow milk. β-Casomorphin-7 has been shown to have potent bronchial and renal proximal effects in rats, as well as analgesic properties. It also inhibits aminopeptidase activity in lung explants and muscle tissues, which may be due to its ability to act on opioid receptors. β-Casomorphin-7 also has been shown to inhibit growth factor production and increase the production of factor β1 in a rat model of pulmonary fibrosis. This may be due to its ability to inhibit inflammation by acting on inflammatory cells such as macrophages or neutrophils.
Formula:C41H55N7O9•4H2OPurezza:Min. 95%Peso molecolare:861.98 g/molProlactin-Releasing Peptide (Rat)
CAS:Prolactin-Releasing Peptide (Rat) is a cyclic 18-amino acid peptide that is an inhibitor of the prolactin releasing hormone. It has been shown to have a high specificity for the prolactin releasing hormone receptor and has been used as a research tool in cell biology and pharmacology. This peptide can be used to study protein interactions, which may be due to its ability to act as an activator or ligand for receptors. Prolactin-Releasing Peptide (Rat) is also able to inhibit ion channels, such as voltage-gated potassium channels and calcium channels. This peptide can also be used to generate antibodies against the prolactin releasing hormone receptor.
Formula:C156H242N54O43SPurezza:Min. 95%Peso molecolare:3,594 g/molBis-dPEG®7-PFP Ester
CAS:Bis-dPEG®7-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®7-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C30H32F10O11Purezza:Min. 95%Peso molecolare:758.55 g/molCRF (Ovine)
CAS:Corticotropin Releasing Factor (CRF) is a peptide hormone involved in the regulation of the neuroendocrine system, the hypothalamic-pituitary-adrenal (HPA) axis. The hypothalamus releases CRF during stress and in turn CRF stimulates the production of stress hormones such as glucocorticoids and adrenocorticotropin (ACTH). A negative feedback loop is created as glucocorticoids then prevents further endocrine activity exhibited by the pituitary gland and hypothalamus. Interestingly in patients with depression, it has been found that the hypothalamic-pituitary adrenal axis is over stimulated thus increased production of CRF occurs resulting in depression symptoms. Furthermore studies have shown the expression of CRF receptors in glial cells and T-cells and elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments.
This product is available as a 0.1mg vial.Formula:C205H339N59O63SPurezza:Min. 95%Peso molecolare:4,670.3 g/molNojirimycin Bisulfite
CAS:Nojirimycin Bisulfite is a potent inhibitor of protein synthesis. It is a receptor-selective ligand that binds to the extracellular domain of the epidermal growth factor (EGF) receptor, thereby inhibiting receptor signaling. Nojirimycin Bisulfite has also been shown to inhibit ion channels and ligand-gated ion channels. Nojirimycin Bisulfite has been shown to bind to both peptides and antibodies, which makes it a useful research tool for studying protein interactions.
Formula:C6H13NO7SPurezza:Min. 95%Peso molecolare:243.23 g/molMargatoxin
CAS:Margatoxin is a research tool that has been shown to activate the nicotinic acetylcholine receptor. It binds to the ligand-binding site of the receptor and blocks ion channel activity. Margatoxin is a small molecule with high purity that can be used as a tool to study protein interactions and biological functions. This compound is also an inhibitor of peptide binding, which can be used in pharmacology studies.
Formula:C178H286N52O50S7Purezza:Min. 95%Peso molecolare:4,178.9 g/molCoV-2 N (127 a.a.)
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019. The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans. While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The E. coli derived recombinant protein contains the Coronavirus 2019 C-terminal region 127 a.a. from the Nucleocapsid protein and fused to GST-6xHis tag at N-terminal and having a M.W. of 39.4 kDa. It has been purified using PNTA Sepharose-Affinity Purification. The CoV-2 Nucleocapsid protein solution is supplied in 50mM Tris-HCl pH 8, 1M Urea, and 50% Glycerol.
Purezza:Min. 95%Beta-Neo-Endorphin (Porcine)
CAS:Beta-Neo-Endorphin is an opioid peptide which binds with high affinity to μ, δ and κ-receptors and has been found to be involved in the modulation of pain, epidermal nerve fiber regulation and skin homeostasis. It is further demonstrated the ability to in human keratinocytes, stimulate wound healing. Beta-neoendorphin is derived from prodynorphin when it is proteolytically cleaved.
This product is available as a 0.5mg vials and is sourced from Porcine.Formula:C54H77N13O12Purezza:Min. 95%Peso molecolare:1,100.3 g/molGIP (Human)
CAS:GIP is a peptide that is produced by the cells of the small intestine. GIP has been shown to be an inhibitor of insulin secretion and, in turn, may help regulate glucose levels. It also regulates growth hormone release in response to food intake. GIP acts as a ligand for the receptor known as the “gastric inhibitory polypeptide receptor” which is found on pancreatic beta cells and duodenal L-cells. This protein has been shown to activate ion channels and regulate their activity. The GIP receptor is also expressed on certain types of cancer cells, including breast cancer and colorectal cancer. Antibodies have been generated against this protein for use in research tools such as Western blotting or immunohistochemistry.Formula:C226H338N60O66SPurezza:Min. 95%Peso molecolare:4,983.5 g/molIL 1 α Human
IL-1α is a cytokine protein that has been shown to be involved in the immune system. IL-1α is an activator of the receptor and is also a ligand for it. The protein has been shown to activate ion channels, which are proteins that allow ions to pass through either by diffusion or by facilitated transport. This activation causes cells to produce more hydrogen ions, which leads to an increase in the acidity of the cell. IL-1α has also been shown to inhibit cell proliferation and induce apoptosis.
Purezza:Min. 95%Suc-Ala-Ala-Ala-pNA
CAS:Suc-Ala-Ala-Ala-pNA is a peptide that binds to the acetylcholine receptor and activates it. This peptide has been shown to have potential as a research tool for studying the pharmacology of acetylcholine receptors in vitro. It has also been used as an inhibitor of neuronal ion channels, such as potassium channels, that are involved in the transmission of nerve impulses. Suc-Ala-Ala-Ala-pNA is not suitable for use in humans because it would be broken down by proteases before it could reach its target, but this peptide has applications in cell biology and neuroscience.Formula:C19H25N5O8Purezza:Min. 95%Peso molecolare:451.43 g/molMAL-dPEG®4-Acid
CAS:MAL-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C18H28N2O9Purezza:Min. 95%Peso molecolare:315.39 g/molLys-AMC
CAS:Lys-AMC is a potent and selective activator of the TRPM2 ion channel. It binds to the extracellular loop of the TRPM2 receptor, which is located in the membrane of cells. Lys-AMC activates TRPM2 by binding to its extracellular loop and opening it, allowing calcium ions to enter the cell. This leads to a change in cellular activity, such as increased production of reactive oxygen species or altered gene expression. Lys-AMC can be used for research purposes or as an inhibitor of TRPM2 channels.br>br> Lys-AMC is a high purity product with a CAS number of 92605-76-0. It has been shown to bind specifically and selectively to TRPM2 receptors without any cross reactivity with other proteins, making it an ideal tool for research purposes. Lys-AMC can be used as an antibody or cell biology reagent that can inhibit TRPM2 channels.br>br>Formula:C16H21N3O3Purezza:Min. 95%Peso molecolare:303.36 g/molLH-RH (Human)
CAS:Prodotto controllatoLuteinizing hormone-releasing hormone (LH-RH), also known as Gonadotropin-Releasing Hormone (GnRH), stimulates the pituitary gland’s production and secretion of luteinizing hormone and follicle-stimulating hormone. LHRH is a decapeptide and is itself secreted by the hypothalamus. It is crucial for human reproduction and is heavily involved in the regulation of ovulation, sexual development and the onset of puberty.
When secreted, GNRH binds to the G-protein coupled receptor, gonadotropin-releasing hormone receptor (GNRHR) located on pituitary gonadotrophic cells in the anterior pituitary.
Medically, the understanding of GnRH is paramount, due to its involvement in the pathogensis of central hypogonadism. Any obstructions to its function in the reproductive system can result in the development of human pathologically conditions. It is important to note that analogs of GnRH can be used in pharmacology, in the treatment of gynaecological diseases, through blocking the secretion of estrogen secretion from the ovary. Additional GNRH analogs can be used to treat ovarian cancer, hormone-dependent cancers, endometriosis and modality in infertility. Therefore this product is a useful research tool.Formula:C55H75N17O13•2CH3COOHPurezza:Min. 95%Peso molecolare:1,302.4 g/molAc-Ile-Glu-Thr-Asp-H (aldehyde)
CAS:Ac-Ile-Glu-Thr-Asp-H (aldehyde) is a peptide fragment of the human calcitonin gene. It is a research tool used in immunology and cell biology. Ac-Ile-Glu-Thr-Asp-H (aldehyde) binds to different types of ion channels, including ligand gated ion channels, voltage gated ion channels, and receptor activated ion channels. Ac-Ile-Glu-Thr-Asp-H (aldehyde) can also bind to membrane receptors such as the muscarinic acetylcholine receptor and the alpha adrenergic receptor. Acetylcholine is a neurotransmitter that activates the muscarinic acetylcholine receptor, which leads to an increase in intracellular levels of cyclic AMP. Alpha adrenergic receptors are located on the surface of blood vessels and activate vasoconstriction by inhibiting adenylyl cyclase activity.
Formula:C21H34N4O10Purezza:Min. 95%Peso molecolare:502.52 g/molAmino-dPEG®36-t-Butyl Ester
CAS:Amino-dPEG®36-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®36-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C79H159NO38Purezza:Min. 95%Peso molecolare:1,731.09 g/molAc-Arg-OMe • HCl
CAS:Ac-Arg-OMe • HCl is a labile peptide that has been shown to be homologous to the human Arg-Gly-Asp (RGD) sequence. Ac-Arg-OMe • HCl is activated by trypsin and trypsin-like proteases, but inactivated by hemolytic activity and conformation. Ac-Arg-OMe • HCl is an enzyme substrate for peptidases such as trypsin and trypsin like proteases. It has been shown to be a molecule that interacts with various proteins, including hemoglobin.
Formula:C9H18N4O3•HCIPurezza:Min. 95%Peso molecolare:266.72 g/molAc-Phe-OEt
CAS:Ac-Phe-OEt is a covalently conjugated bifunctional peptide that has been synthesized by linking the amino acid phenylalanine to the amino acid ethyl ester of oleic acid. Ac-Phe-OEt exhibits a high affinity for bacterial serine proteases (Km=0.1 μM) and lysine residues (Ki=4 μM). This peptide also binds to immobilized cytochalasin, which prevents the formation of amyloid fibrils. Ac-Phe-OEt can be used in enzyme catalysis as an inhibitor or competitive inhibitor, as well as being immobilized on surfaces. The kinetic data suggests that Ac-Phe-OEt competes with lysine residues for binding to bacterial serine proteases and inhibits their activity.Formula:C13H17NO3Purezza:Min. 95%Peso molecolare:235.28 g/molApelin-36 (Human)
CAS:Apelin-36 is a peptide hormone that is derived from a larger precursor protein. It is a member of the apelin peptide family, which is involved in regulating cardiovascular and metabolic functions. Apelin-36 binds to a G protein-coupled receptor called APJ (apelin receptor), which is widely expressed in various tissues. The interaction between apelin-36 and APJ receptor leads to a range of physiological effects, such as cardiac contractility stimulation and blood pressure suppression as well as lowering body weight and improving glucose homeostasis. Research has shown that apelin-36 may have therapeutic potential in the treatment of cardiovascular diseases, such as hypertension and heart failure, as well as metabolic disorders, such as obesity and diabetes. Apelin-36 has also been implicated in other physiological processes, including inflammation, angiogenesis, and cancer progression. This product is available as a 0.1 mg vial.Formula:C184H297N69O43SPurezza:Min. 95%Peso molecolare:4,195.8 g/molZ-Tyr-ONp
CAS:Z-Tyr-ONp is a synthetic, water soluble, non-toxic fibrinogen activator. It has been shown to be effective at low concentrations in the activation of fibrinogen and in the prevention of clotting. Z-Tyr-ONp hydrolyzes fibrinogen to form fibrin clots, which are needed for blood coagulation. This process is mediated by the enzyme alpha-thrombin and is dependent on calcium ions. Z-Tyr-ONp also exhibits surfactant properties that allow it to stabilize micelles that contain lipase enzymes and bile salts, which are required for digestion of dietary fats. The presence of lipase enzymes can enhance the proteolytic activity of Z-Tyr-ONp and increase its ability to dissolve clots.
Formula:C23H20N2O7Purezza:Min. 95%Peso molecolare:436.41 g/molBis-dPEG®3-Acid
CAS:Bis-dPEG®3-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®3-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C45H55F4NO11Purezza:Min. 95%Peso molecolare:861.92 g/molTyrosyl-CRF (Human, Rat)
CAS:Tyrosyl-CRF is a protein-based activator of the catecholamine receptor. It can be used as a research tool to study the function of the catecholamine receptor and ion channels, or as an inhibitor of these receptors. Tyrosyl-CRF binds to the alpha subunit of the catecholamine receptor. This binding causes conformational changes in the receptor that activate it when tyrosine residues are present in the cytoplasmic domain. Tyrosyl-CRF is also able to bind to other proteins such as peptides and antibodies, which may have therapeutic potential for use in diseases such as cancer, Alzheimer's disease, and Parkinson's disease.Formula:C217H353N61O65S2Purezza:Min. 95%Peso molecolare:4,920.6 g/molCbz-N-Amido-dPEG®24-Acid
CAS:Cbz-N-Amido-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Cbz-N-Amido-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Purezza:Min. 95%Peso molecolare:1,280.49 g/molMethionine-Enkephalin (Human, Porcine, Bovine, Rat, Mouse)
CAS:Methionine-Enkephalin (ME) is a peptide that has been shown to bind to the opioid receptor and inhibit the production of pro-inflammatory cytokines. ME has been shown to have an inhibitory effect on human liver cells, as well as on cultured human epidermal cells. ME may also have a role in epidermal growth factor receptors, which could be related to its anti-inflammatory effects.
Formula:C27H35N5O7S•H2OPurezza:Min. 95%Peso molecolare:591.68 g/molSPDP-dPEG®36-NHS Ester
CAS:SPDP-dPEG®36-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®36-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C87H161N3O41S2Purezza:Min. 95%Peso molecolare:1,969.33 g/molm-dPEG®24-Amine
CAS:m-dPEG®24-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purezza:Min. 95%Peso molecolare:1,088.32 g/molAc-Tyr-Val-Lys-Asp-H (aldehyde)
CAS:Ac-Tyr-Val-Lys-Asp-H (aldehyde) is a peptide that is used as a research tool in cell biology and pharmacology. Ac-Tyr-Val-Lys-Asp-H (aldehyde) is an inhibitor of the ion channels TRPV1 and TRPA1, which are involved in pain perception. Ac-Tyr-Val-Lys-Asp-H (aldehyde) also binds to the receptor for bradykinin, which is involved in inflammatory reactions. Ac-Tyr-Val-Lys-Asp-H (aldehyde) has been shown to inhibit protein interactions with the receptors for acetylcholine, serotonin, histamine, dopamine, and other neurotransmitters. The CAS number for this compound is 178603–78–6Formula:C26H39N5O8Purezza:Min. 95%ANP (Human, 1-28)
CAS:ANP (Human, 1-28) is a peptide with the sequence of amino acids 1-28 of the human atrial natriuretic peptide. ANP (Human, 1-28) is an activator of the receptor for ANP which belongs to the G protein coupled receptor superfamily. This peptide has been shown to inhibit ion channels and ligands and can be used as a research tool in cell biology, such as cell culture and immunohistochemistry.Purezza:Min. 95%Amino-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3
CAS:Amino-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C3H5NPurezza:Min. 95%Peso molecolare:55.08 g/molAmino-dPEG®6-acid
CAS:Amino-dPEG®6-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®6-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C15H31NO8Purezza:Min. 95%Peso molecolare:353.41 g/molm-dPEG®4-OH
CAS:m-dPEG®4-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, m-dPEG®4-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C19H30N2O7S2Purezza:Min. 95%Peso molecolare:462.58 g/molCarboxyl-dPEG®4-(m-dPEG®4)3
CAS:Carboxyl-dPEG®4-(m-dPEG®4)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Carboxyl-dPEG®4-(m-dPEG®4)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C180H350N6O88Purezza:Min. 95%Peso molecolare:4,006.69 g/molXenin-25 (Human)
CAS:Xenin-25 is a peptide that is an activator of ion channels. It is used as a research tool and in antibody production to study the binding of antibodies to their receptors. Xenin-25 can be used to inhibit protein interactions, such as receptor-ligand or enzyme-substrate interactions. It has been shown to have pharmacological effects on ligand binding and ion channel activation, which may be due to its ability to bind to proteins with high affinity and specificity.
Formula:C139H224N38O32SPurezza:Min. 95%Peso molecolare:2,971.6 g/molBis-dPEG®3-PFP Ester
CAS:Bis-dPEG®3-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®3-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C22H16F10O7Purezza:Min. 95%Peso molecolare:582.34 g/molElastatinal
CAS:Elastatinal is a research tool that is used to activate cells by binding to a receptor on the cell surface. Elastatinal belongs to the Ligand class of compounds and has been shown to bind to various ion channels and receptors, including cell surface receptors. This ligand binds with high affinity to the α-adrenergic receptor (α-AR) and activates cells that express this receptor. It also inhibits the binding of other ligands, such as bradykinin, which may be useful in pharmacology. Elastatinal is an inhibitor of protein interactions, which can be used in Cell Biology studies.Formula:C21H36N8O7Purezza:Min. 95%Peso molecolare:512.56 g/molGlucagon-like Peptide 1 (Human, 7-36 Amide)
CAS:Glucagon-like peptide 1 (GLP-1) is a peptide hormone that belongs to the glucagon family. It is a 36 amino acid polypeptide and is naturally synthesized in the ileum of humans, pigs, and cows. GLP-1 is an activator of ion channels, which are protein structures that regulate the flow of ions across cell membranes. This hormone also has been shown to inhibit the activity of protein interactions at the cell membrane or ligand binding to receptors.Formula:C149H226N40O45Purezza:Min. 95%Peso molecolare:3,297.6 g/molNPY (Human, Rat)
CAS:NPY is a potent inhibitor of the ion channel TRPM2. This protein has been shown to be involved in a variety of physiological functions, including regulation of body weight and food intake, sleep-wake cycles, and pain perception. It is also an important regulator of neuronal excitability. NPY (Human) can be used as a research tool for studying protein interactions or investigating the function of ion channels in cellular systems. NPY (Rat) can be used as an antibody for immunohistochemistry or Western blotting experiments.Formula:C189H285N55O57SPurezza:Min. 95%Peso molecolare:4,271.7 g/molSubstance P (Human, Bovine, Rat, Mouse)
CAS:Substance P is a member of the tachykinin neuropeptide family which is produced in the central nervous system (CNS) and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research. This product is available as a 0.5 mg vial.Formula:C63H98N18O13SPurezza:Min. 95%Peso molecolare:1,347.6 g/molAmino-dPEG®8-t-butyl ester
CAS:Amino-dPEG®8-t-butyl ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®8-t-butyl ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C32H58N2O15Purezza:Min. 95%Peso molecolare:710.81 g/molNHS-dPEG®4-Biotin
CAS:NHS-dPEG®4-Biotin is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4-Biotin is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C22H32N2O13Purezza:(%) Min. 98%Peso molecolare:532.5 g/molEndothelin-3 (Human)
CAS:Endothelin-3 (ET-3) is a protein that belongs to the large family of endothelin peptides which activate the G-protein coupled receptors ETA and ETB. However ET-3 has lower affinity for the ETA receptors compared to Endothelin-1 (ET-1) and Endothelin-2 (ET-2), whereas all three endothelins have similar affinity for ETB receptors. As ETB receptors make up around 90% of the endothelin receptors found in the cerebral cortex in humans, ET-3 can be nicknamed the ‘brain endothelin’. Also through ET-3’s activation of ETB receptors, ET-3 is involved in the development of the enteric nervous system which controls within the gut, blood flow, secretion and intestinal motility. This product has disulfide bonds between Cys1-Cys and Cys3-Cys11, is sourced from Porcine, Rat and Rabbit and is available as a 0.1mg vial. It can be use as a research tool for studying the function of endothelin receptors.
Formula:C121H168N26O33S4Purezza:Min. 95%Peso molecolare:2,643 g/molBis-dPEG®21-PFP Ester
CAS:Bis-dPEG®21-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®21-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C58H88F10O25Purezza:Min. 95%Peso molecolare:1,375.29 g/molNeuromedin C (Human, Porcine, Canine)
CAS:Neuromedin C (NMC) is a peptide that belongs to the family of neuromedin and is a potent activator of ion channels. It has been shown to be a ligand for opioid receptors, which may be due to its ability to inhibit the release of neurotransmitters such as acetylcholine and noradrenaline. Neuromedin C has also been shown to inhibit the binding of morphine-6 beta-glucuronide in rat brain synaptosomes. In addition, NMC has been reported as an inhibitor of cell proliferation and induce apoptosis in various cancer cells including colon and prostate cancers.
Formula:C50H73N17O11SPurezza:Min. 95%Peso molecolare:1,120.3 g/molBiotin-dPEG®7-Azide
CAS:Biotin-dPEG®7-Azide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®7-Azide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C26H48N6O9SPurezza:Min. 95%Peso molecolare:620.32 g/molBiotin-dPEG®7-NH2
CAS:Biotin-dPEG®7-NH2 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®7-NH2 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C26H50N4O9SPurezza:Min. 95%Peso molecolare:594.76 g/molGRP (Human)
CAS:GRP (Human) is a protein that belongs to the group of peptides. It is an activator of G-protein coupled receptors. GRP (Human) has been shown to be a ligand for the receptor GPVI, which is involved in the activation of platelets and megakaryocytes. GRP (Human) can also inhibit ion channels, such as voltage-gated sodium channels or calcium channels. This protein is used in research for studying cell biology and pharmacology. GRP (Human) is purified at high purity by a process involving chromatography and gel filtration.Formula:C130H204N38O31S2Purezza:Min. 95%Peso molecolare:2,859.4 g/molDeoxyribonuclease I Bovine
CAS:Deoxyribonuclease I Bovine is an enzyme extracted from pancreas, thymus, or bovine tissue culture. It may be used to digest proteins in order to remove damaged linkages and produce a soluble protein-free extract. Deoxyribonuclease I Bovine can also be used for the removal of DNA from cells, tissues, and organs for biochemical methods such as biochemical assays, immunoassays, and nucleic acid amplification.Purezza:Min. 95%Fmoc-N-Amido-dPEG®8-NHS Ester
CAS:Fmoc-N-Amido-dPEG®8-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®8-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C38H52N2O14Purezza:Min. 95%Peso molecolare:760.82 g/mol[D-Ala2,D-Leu5]-Enkephalin
CAS:[D-Ala2,D-Leu5]-Enkephalin is a peptide that has been shown to activate certain opioid receptors and inhibit ion channels. It is also known to be an antagonist of the D2 receptor. This compound has a high purity and can be used as a research tool for studies in cell biology, pharmacology, and life sciences.
Formula:C29H39N5O7Purezza:Min. 95%Peso molecolare:569.65 g/molAmino-dPEG®8-OH
CAS:Amino-dPEG®8-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, amino-dPEG®8-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C16H35NO8Purezza:Min. 95%Peso molecolare:369.45 g/molDes-Arg9-[Leu8]-Bradykinin
CAS:Prodotto controllatoBradykinin is a peptide hormone that can be formed from the breakdown of kininogen. It works by binding to specific receptors found on the surface of cells and activating a G-protein coupled receptor. Bradykinin stimulates the secretion of gastric acid, increases the permeability of capillaries in the lungs, and causes contraction of smooth muscle in many organs. Bradykinin also has an important role in regulating blood pressure and heart rate. Des-Arg9-[Leu8]-Bradykinin (D-BK) is a potent inhibitor of this activity and is used as an antihypertensive agent. D-BK prevents the activation of G-proteins by binding to receptors with high affinity and specificity. When it binds to its receptor, it inhibits cyclic AMP production, which leads to decreased cell activity and vasodilation. This inhibition reduces blood pressure by reducing cardiac output and increasing systemic vascular resistance.Formula:C41H63N11O10•CH3COOH•3H2OPurezza:Min. 95%Peso molecolare:984.11 g/moldPEG®48-Biotin Acid
CAS:dPEG®48-Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®48-Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C112H218N4O53SPurezza:Min. 95%Peso molecolare:2,500.99 g/molAzido-dPEG®23-Amine
CAS:Azido-dPEG®23-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®23-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C48H98N4O23Purezza:Min. 95%Peso molecolare:1,099.3 g/molZ-Gly-Leu
CAS:Z-Gly-Leu is a monoclonal antibody that inhibits the enzyme protease. It binds to the active site of the enzyme and prevents it from cleaving peptides into smaller fragments. The antibody also binds to casein, a protein found in milk, and soybean trypsin inhibitor. This prevents these enzymes from degrading other proteins in the body. The antibody is reactive at phase transition temperatures and has been shown to be effective on wild-type mice.Formula:C16H22N2O5Purezza:Min. 95%Peso molecolare:322.36 g/molSomatostatin (Human, Ovine, Porcine, Rat, Mouse)
CAS:Somatostatin is a peptide hormone that is widely expressed throughout the body; in the gastrointestinal (GI) tract, hypothalamus, pancreas and the central nervous system. It has been found to inhibit pituitary growth hormone release as well as endocrine, pancreatic and GI secretions. In the central nervous system somatostatin plays a role in neurotransmission modification and it has also demonstrated to be effective against a number of cancers such as squamous carcinoma. This product contains disulfide bonds between Cys3-Cys14.Formula:C76H104N18O19S2•2CH3COOH•6H2OPurezza:Min. 95%Peso molecolare:1,866.1 g/molBis-dPEG®7-Acid
CAS:Bis-dPEG®7-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®7-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Formula:C22H39NO12Purezza:Min. 95%Peso molecolare:509.54 g/molAc-Tyr-NH2
CAS:Ac-Tyr-NH2 is a rotameric peptide that has been shown to inhibit the growth of bacteria. It is a neutral compound and does not have any detectable effect on human serum. Ac-Tyr-NH2 has been shown to react with tryptophan, which may be due to its acid hydrolysis. This peptide also has an active role in the production of reaction products and the formation of model proteins. Ac-Tyr-NH2 has been shown to have an optical property of fluorescence, which can be used for skin reactions or uv absorption.Formula:C11H14N2O3Purezza:Min. 95%Peso molecolare:222.24 g/molBis-dPEG®5-PFP Ester
CAS:Bis-dPEG®5-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®5-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C26H24F10O9Purezza:Min. 95%Peso molecolare:670.45 g/molMAL-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3
CAS:MAL-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C10H11NO5Purezza:Min. 95%Peso molecolare:225.2 g/molAnti Secretin (Porcine) Serum (50 ul)
CAS:Anti-Secretin (Porcine) Serum is a high purity, serum-based protein that is used in research and cell biology experiments. It contains a variety of proteins including antibodies, activators, inhibitors, and peptides. Anti-Secretin (Porcine) Serum is used to study the function of ions channels and ligands. This product also has a wide range of applications in pharmacology and cell biology. The CAS number for this product is 109376-05-8.
Formula:C32H49N11O8Purezza:Min. 95%Peso molecolare:715.8 g/molAmyloid β-Protein (Human, 1-38)
CAS:Amyloid β-Protein (Human, 1-38) is a peptide that is a major constituent of the amyloid plaques found in the brains of people with Alzheimer's disease. It has been shown to inhibit ion channels and ligand-activated ion channels. The receptor for this protein is unknown, but it may be involved in cell signaling or neurotransmitter release. Amyloid β-Protein (Human, 1-38) can be used as a research tool to study proteins and their interactions with other proteins, as well as to study how these interactions affect the function of cells. It can also be used to study how antibody molecules bind to specific proteins and how these antibodies interact with other molecules.
Formula:C184H277N51O56SPurezza:Min. 95%Peso molecolare:4,131.5 g/molAzido-dPEG®11-amine
CAS:Azido-dPEG®11-amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®11-amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C49H99N3O24Purezza:Min. 95%Peso molecolare:1,114.32 g/mol[Pyr11]-Amyloid β-Protein (Human,11-40) (0.5 mg Vial)
CAS:[Pyr11]-Amyloid β-Protein (Human,11-40) is a peptide fragment of amyloid beta protein that is found in the brain. It has been shown to bind to receptors and activate ion channels. The binding of amyloid beta to these receptors may play a role in Alzheimer's disease and other neurological disorders. This product is for research purposes only, not for use in diagnostic procedures.Formula:C143H226N38O39SPurezza:Min. 95%Peso molecolare:3,133.6 g/mol[D-Arg1,D-Trp7,9,Leu11]-Substance P
CAS:This product is a Substance P antagonist in the Hydrochloride salt from and as a 0.5mg vial. Substance P is a neuropeptide that acts as a neurotransmitter and neuromodulator. It is best known for its role in nociception or pain perception. Substance P is also involved in other biological processes such as the regulation of gastrointestinal motility and the inflammatory response. As a tachykinin neuropeptide, substance P acts through binding to its specific neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is also involved in: increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.
Formula:C75H108N20O13Purezza:Min. 95%Peso molecolare:1,497.8 g/molm-dPEG®12-Amine
CAS:m-dPEG®12-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®12-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Purezza:Min. 95%Peso molecolare:559.69 g/molTuftsin
CAS:Tuftsin is a ligand with the ability to activate specific receptors. It is also known as Activator, and is a reagent that can be used in research for cell biology and pharmacology. Tuftsin has been shown to bind to ion channels and act as an inhibitor of these channels. This activity leads to the inhibition of calcium influx into cells, which may be important for regulating cellular processes such as apoptosis, cytoskeletal rearrangement, or protein synthesis. It may also play a role in immune response pathways.Formula:C21H40N8O6Purezza:Min. 95%Peso molecolare:500.6 g/moldPEG®12-diol
CAS:dPEG®12-diol is a synthetic compound that has high purity, an excellent shelf life, and can be used as a research tool or as a pharmaceutical. The synthesis of dPEG®12-diol involves the coupling of two molecules of 12-deoxyphosphatidylcholine with 1,2-di(2′-ethylhexyl)-glycerol (DEHG). This process results in the formation of dPEG®12-diol. dPEG®12-diol is a potent inhibitor of ion channels and has been shown to affect cellular metabolism. It has also been shown to have anti-inflammatory effects in vitro and in vivo.
Formula:C17H37NO8Purezza:Min. 95%Peso molecolare:383.48 g/molDNP-dPEG®12-NHS Ester
CAS:DNP-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DNP-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C60H110N6O28Purezza:Min. 95%Peso molecolare:1,363.54 g/molNeuromedin U (Rat)
CAS:Neuromedin U is a peptide that is found in the brain and has been shown to have a variety of effects on the body. It can be used as an activator or inhibitor of ion channels and has been shown to inhibit ligand-gated ion channels. Neuromedin U can also act as a ligand for G-protein coupled receptors, which are involved in many physiological processes. The high purity of this product makes it suitable for use in research tools such as antibodies.Formula:C124H180N34O31Purezza:Min. 95%Peso molecolare:2,643 g/molCoV-2 N (329 a.a.)
SARS-CoV is a coronavirus that causes SARS. This protein is the nucleocapsid protein of SARS-CoV and is encoded by the ORF2 gene. This protein is a component of the viral nucleocapsid, which contains the viral genomic RNA. Antibodies against this protein are used in serological tests to detect recent infection with SARS-CoV or SARS-CoV/SARS-CoV-2. COVID-19 (also known as 3C8) is an antibody that specifically binds to this protein and can be used as a diagnostic marker for SARS.Purezza:Min. 95%MOCAc-Pro-Leu-Gly-Leu-A2pr(Dnp)-Ala-Arg-NH₂
CAS:MOCAc-Pro-Leu-Gly-Leu-A2pr(Dnp)-Ala-Arg-NH₂ is a peptide that is used as a research tool in cell biology. It can be used to study the interactions between proteins, receptors and ion channels. MOCAc-Pro-Leu-Gly-Leu-A2pr(Dnp)-Ala-Arg-NH₂ has been shown to activate the G protein receptor, which is involved in the transmission of signals by cells. The peptide is also an inhibitor for ligand binding to the receptor.
Formula:C49H68N14O15Purezza:Min. 95%Peso molecolare:1,093.10 g/molAmyloid Beta-Protein (Human, 1-40) (TFA Form)
CAS:Amyloid beta-protein (Aβ) is a peptide that is believed to play an important role in the development of Alzheimer's disease. Aβ is produced by proteolytic cleavage from the amyloid precursor protein and is released into the extracellular space, where it can interact with other cells. The protein has been shown to activate ion channels and inhibit cell proliferation. It also binds to receptors on cells, which leads to downstream effects such as inhibition of ligand binding and activation of G-protein coupled receptor signaling pathways.Formula:C194H295N53O58SPurezza:Min. 95%Peso molecolare:4,329.8 g/molNHS-dPEG®4 Biotin
CAS:NHS-dPEG®4 Biotin is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4 Biotin is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purezza:Min. 95%Peso molecolare:588.67 g/molGlu-Glu
CAS:Glu-Glu is a mouse monoclonal antibody (IgG2a) that inhibits the activity of human leukocyte elastase. Glu-Glu has been shown to inhibit the production of inflammatory cytokines, such as IL-8 and TNF-α, in human serum obtained from patients with chronic cough. It also blocks the formation of disulfide bonds in peptides and proteins, which are important for their function. Glu-Glu has been used to study pathogenic mechanisms of chronic obstructive pulmonary disease and metabolic disorders, as well as its effects on polymerase chain reactions and enzyme activities in vitro.
Formula:C9H14N4O3Purezza:Min. 95%Peso molecolare:226.23 g/molMOCAc-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH₂
CAS:MOCA-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 is a synthetic peptide that interacts with the nicotinic acetylcholine receptor and is a potent agonist. MOCA was found to be a potent activator of the nicotinic acetylcholine receptor, as well as an inhibitor of ligand binding. The affinity for binding to the receptor was found to be high, with an inhibition constant (Ki) of 0.06 μM. It has been shown to inhibit ion channels and ligand binding in cell biology experiments. MOCA can also be used as a research tool for studying protein interactions and receptors.
Formula:C78H110N22O20Purezza:Min. 95%Peso molecolare:1,675.8 g/molSPDP-dPEG®12-NHS Ester
CAS:SPDP-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C33H57N3O18Purezza:Min. 95%Peso molecolare:783.82 g/molAzido-dPEG®4-acid
CAS:Azido-dPEG®4-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C51H101N3O26Purezza:Min. 95%Peso molecolare:1,172.35 g/molBoc-Gln-Arg-Arg-AMC
CAS:Boc-Gln-Arg-Arg-AMC is a Research Tool that is used to study the interactions of protein ligands with receptor and ion channels. It has been shown to inhibit the activity of ion channels, such as calcium and potassium channels.Formula:C32H49N11O8Purezza:Min. 95%Peso molecolare:715.8 g/molBradykinin-Potentiator C
CAS:Bradykinin-Potentiator C is a peptide that can act as an activator or inhibitor of ion channels. It has been used in research for pharmacology, protein interactions, cell biology, and antibody production. Bradykinin-Potentiator C is purified from rabbit lung and has a CAS number of 30953-20-9.Formula:C51H77N11O13Purezza:Min. 95%Peso molecolare:1,052.2 g/molVirus Replication Inhibiting Peptide
CAS:The virus replication-inhibiting peptide is a fatty acid that inhibits the replication of viruses. It has been shown to inhibit the growth of the bacteria Stenotrophomonas maltophilia and other bacteria, which causes infectious diseases. The peptide also has a diagnostic use for detecting viral infections in cells. The peptide was found to up-regulate genes in response to infection by pandemic influenza, which may be due to its ability to bind receptors on cells and also interfere with inflammatory responses. The virus replication-inhibiting peptide has been shown to be effective against influenza virus and other viruses, as well as against chronic inflammatory diseases such as lung damage caused by β-amino acids.
Formula:C28H29N3O6Purezza:Min. 95%Peso molecolare:503.55 g/molBis-MAL-dPEG®11
CAS:Bis-MAL-dPEG®11 is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-MAL-dPEG®11 is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C65H105F4N9O21S2Purezza:Min. 95%Peso molecolare:1,488.7 g/molBoc-Gln-Pro
CAS:Boc-Gln-Pro is a peptide that can be used as a substrate for peptidoglutaminase.
Formula:C15H25N3O6Purezza:Min. 95%Peso molecolare:343.38 g/molGRF (Human)
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C215H358N72O66SPurezza:Min. 95%Peso molecolare:5,039.7 g/molFmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH
CAS:Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH is a peptide that belongs to the group of carbohydrate derivatives. It has been shown to inhibit the growth of bacteria and fungi by inhibiting protein synthesis. The amino acid sequence is Ser-Gly-Gly-Gly-Ala-Ser, which has a high affinity for bacterial cell walls. Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH binds to bacterial cell walls by competitive inhibition of the enzyme D, L aminopimelate aminotransferase (EC 2.6.1.19). This binding prevents the formation of an antibiotic inhibitor complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.Formula:C44H52N2O21Purezza:Min. 95%Peso molecolare:944.88 g/molCGRP (Human)
CAS:CGRP (calcitonin gene-related peptide) is a 37-amino acid neuropeptide that is found in humans and is widely distributed in the nervous system, particularly in sensory neurons, and is involved in the regulation of vascular tone, blood flow, pain perception, and inflammation. It is a potent vasodilator and has been implicated in the pathophysiology of several vascular disorders, including migraine headaches, cluster headaches, and hypertension.
In addition to its vascular effects, human CGRP also has neuroprotective properties and has been investigated as a potential therapeutic agent for various neurological disorders, such as Alzheimer's disease and Parkinson's disease.
Human CGRP has been extensively studied as a research tool to investigate its physiological and pathological roles in various tissues and diseases. It has also been targeted by pharmacological agents, such as CGRP antagonists and antibodies, for the treatment of migraine headaches and other conditions associated with CGRP dysfunction.
This product is available as a 0.5mg vial.Formula:C163H267N51O49S2Purezza:Min. 95%Peso molecolare:3,789.3 g/molMAL-dPEG®4-(m-dPEG®12)3
CAS:MAL-dPEG®4-(m-dPEG®12)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®12)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C84H158N6O40Purezza:Min. 95%Peso molecolare:1,892.17 g/molTuftsin
CAS:Prodotto controllatoTuftsin is a cyclic peptide that has been shown to have various biological properties, including anti-inflammatory and immunosuppressive activity. Tuftsin has been shown to inhibit the production of proinflammatory cytokines such as IL-10 by T cells in vitro. Tuftsin also inhibits the activation of toll-like receptors (TLR) and may have a role in inhibiting mycobacterial infection. This drug was found to be well tolerated in humans with congestive heart failure, and is currently being evaluated for its potential use as an adjunct therapy for inflammatory bowel disease. It has also been shown to be effective against opportunistic fungal infections, such as Candida albicans, Cryptococcus neoformans, and Aspergillus fumigatus. Tuftsin can be measured using analytical methods such as titration calorimetry or polymerase chain reaction (PCR).Formula:C21H40N8O6•2CH3COOH•4H2OPurezza:Min. 95%Peso molecolare:692.75 g/molFmoc-N-Amido-dPEG®6-Acid
CAS:Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purezza:Min. 95%Peso molecolare:575.65 g/mol[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide)
CAS:[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide) is a product sourced from bovine, is available as a 0.5mg vial and is related to the peptide hormone Parathyroid Hormone (PTH). During abnormal serum calcium levels PTH is secreted from the parathyroid gland, thus regulating calcium and phosphate levels in the body. PTH binds to its PTH receptor which is a G-protein coupled receptor that activated adenylate cyclase or phospholipase C to activate pathways involved in the mediation of bone resorption and bone formation.
Formula:C156H244N48O40S2Purezza:Min. 95%Peso molecolare:3,496 g/molAzido-dPEG®12-Acid
CAS:Azido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Purezza:Min. 95%Peso molecolare:643.72 g/molUrocortin (Rat)
CAS:Urocortin is a peptide that is also known as corticotropin-releasing factor (CRF). It is an inhibitor of the protein phosphatase 1 and protein phosphatase 2A, which are enzymes that regulate the activity of other proteins. Urocortin also has the ability to bind to receptors for glucocorticoid hormones, such as GRP and MR, in a manner that activates them. This peptide is used in research studies to study ion channels, neuronal excitability, and other aspects of cell biology. Urocortin has been shown to be a high purity reagent with no detectable impurities.Formula:C206H338N62O64Purezza:Min. 95%Peso molecolare:4,707.3 g/molACTH (Human 1-24)
CAS:ACTH (1-24) is a peptide hormone and neurotransmitter that belongs to the corticotropin-releasing factor family. It is also known as corticotropin-releasing hormone, adrenocorticotropic hormone, or CRH. ACTH binds to the ACTH receptor, which activates protein kinase A and cyclic AMP response element binding protein (CREB). Activation of these proteins leads to an increase in the production of cortisol. ACTH can be used as a research tool for studying ion channels and ligands. It can also be used as an antibody in cell biology research.
Formula:C136H210N40O31SPurezza:Min. 95%Peso molecolare:2,933.4 g/molm-dPEG®4-Thiol
CAS:m-dPEG®4-Thiol is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Thiol is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C57H113NO25S2Purezza:Min. 95%Peso molecolare:1,276.63 g/molLipoamido-dPEG®12-Acid
CAS:Lipoamido-dPEG®12-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®12-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.
Formula:C25H41N3O7S2Purezza:Min. 95%Peso molecolare:559.74 g/molAzido-dPEG®35-Amine
CAS:Azido-dPEG®35-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®35-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purezza:Min. 95%Peso molecolare:1,627.94 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Galactopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-galactopyranosyl fluoride (TATA) is a fluorinated sugar that is used as a building block for the synthesis of peptides and other biochemicals. TATA has been shown to be an inhibitor of bacterial growth in medium containing glycosyl residues. This product has also been shown to have anti-inflammatory properties in animal models.
Formula:C14H19O9FPurezza:Min. 95%Peso molecolare:350.29 g/molLipoamido-dPEG®24-Acid
CAS:Lipoamido-dPEG®24-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®24-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.
Formula:C39H69N3O15S2Purezza:Min. 95%Peso molecolare:884.11 g/molAmino-dPEG®12-t-Butyl Ester
CAS:Amino-dPEG®12-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C31H63NO14Purezza:Min. 95%Peso molecolare:673.83 g/molPropargyl-dPEG®1-NHS Ester
CAS:Propargyl-dPEG®1-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Propargyl-dPEG®1-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C48H98N4O23Purezza:Min. 95%Peso molecolare:1,099.3 g/molParathyroid Hormone (Human, 1-34)
CAS:This product which is available as a 0.1mg vial is amino acids 1-34 of the 84 amino acid parathyroid hormone (PTH) and can be used as an adenylate cyclase and bone growth stimulating peptide. It is also an effective anabolic agent used in the treatment of some forms of Osteoporosis. PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications.Formula:C181H291N55O51S2Purezza:Min. 95%Peso molecolare:4,117.7 g/moldPEG®24-Biotin Acid
CAS:dPEG®24-Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®24-Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C61H117N3O28SPurezza:Min. 95%Peso molecolare:1,325.6 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Glucopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl fluoride is a glycosyl fluoride that inhibits the enzyme glucosidase. This compound has been shown to inhibit peptide degradation and is used in studies of proteolytic enzymes. 2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl fluoride has also been used as an inhibitor of carbohydrate metabolism and in the synthesis of glycoproteins.Formula:C14H19O9FPurezza:Min. 95%Peso molecolare:350.29 g/molm-dPEG®8-Thiol
CAS:m-dPEG®8-Thiol is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Thiol is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C34H66N4O13SPurezza:Min. 95%Peso molecolare:770.97 g/molm-dPEG®15-Amine
CAS:m-dPEG®15-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®15-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C59H109NO28Purezza:Min. 95%Peso molecolare:1,280.49 g/molFmoc-MeDbz
CAS:Fmoc-MeDbz is an antimicrobial peptide that has been synthesized using solid-phase synthesis. The peptide is composed of the unusual amino acids Fmoc-Me and Dbz. It is a cyclic peptide with an amide bond at its C-terminus. Fmoc-MeDbz has a neutral ph value and can be activated using chemical ligation and modifications to improve its stability. Synthetic analogs of this peptide have also been developed to improve its antibacterial activity against various bacterial strains such as methicillin resistant Staphylococcus aureus (MRSA).
Formula:C23H20N2O4Purezza:Min. 95%Peso molecolare:388.42 g/molAlpha-MSH (Human, Porcine, Bovine, Rat, Mouse)
CAS:Alpha-MSH is a peptide that binds to the Melanocortin 1 receptor. Alpha-MSH is a peptide hormone and neurotransmitter that is involved in the regulation of numerous physiological processes, including appetite, sexual desire, immune response, and skin pigmentation. In addition to its role as a natural hormone, it has been studied as a potential drug for the treatment of obesity and other diseases. The product can also be used as an antibody probe for Western blotting or immunohistochemistry. The product is produced synthetically.Formula:C77H109N21O19SPurezza:Min. 95%Peso molecolare:1,664.9 g/molCyclo(Ala-Pro) (Bulk)
CAS:Cyclo(Ala-Pro) is a cyclic peptide that has been shown to inhibit the growth of endophytic fungi. It also has hydroxyl group and a regulatory function, which may be due to its ability to bind to DNA or RNA. Cyclo(Ala-Pro) can be used as a food additive for animal health purposes.
Formula:C8H12N2O2Purezza:Min. 95%Peso molecolare:168.19 g/molPyr-Ala
CAS:Pyr-Ala is a peptide that has been shown to be effective in treating inflammatory diseases. It specifically targets the group P2 sequences of the inflammatory cytokine IL-1β. Pyr-Ala also inhibits IL-6 and TNF-α activity by binding to the amide bond of these molecules, inhibiting their catalysis and preventing their formation. Pyr-Ala has also shown efficacy in autoimmune diseases, such as rheumatoid arthritis, by inhibiting the production of proinflammatory cytokines including IL-1β and TNF-α. This drug binds to the bacterial enzyme that catalyzes the conversion of L -alanine into pyruvic acid, preventing its function and inhibiting bacterial growth.
Formula:C8H12N2O4Purezza:Min. 95%Peso molecolare:200.19 g/molAzido-dPEG®8-Acid
CAS:Azido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purezza:Min. 95%Peso molecolare:467.51 g/molAngiotensin IV acetate
CAS:Angiotensin IV (human) is an active analogue of the chemoattractant protein, angiotensin. It is a potent anti-inflammatory cytokine that inhibits the production of pro-inflammatory cytokines, such as IL-10. Angiotensin IV (human) has been shown to significantly reduce the production of pro-inflammatory cytokines in mice with chronic inflammation and can be used to treat autoimmune diseases. The biological properties of this protein have been studied using polymerase chain reactions and cytosolic calcium assays. It has been shown to inhibit binding to both the angiotensin receptor and angiotensin converting enzyme. Angiotensin IV (human) also has locomotor activity.Formula:C40H54N8O8Purezza:Min. 95%Peso molecolare:774.91 g/molFmoc-N-Amido-dPEG®4-t-boc-Hydrazide
CAS:Fmoc-N-Amido-dPEG®4-t-boc-Hydrazide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®4-t-boc-Hydrazide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C31H43N3O9Purezza:Min. 95%Peso molecolare:601.69 g/molFmoc-N-Amido-dPEG®12-NHS Ester
CAS:Fmoc-N-Amido-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C46H68N2O18Purezza:Min. 95%Peso molecolare:937.03 g/molAmino-dPEG®24-OH
CAS:Amino-dPEG®24-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, Amino-dPEG®24-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C48H99NO24Purezza:Min. 95%Peso molecolare:1,074.29 g/mol[Sar1,Ile8]-Angiotensin II
CAS:Sar1,Ile8]-Angiotensin II is a peptide that acts as an inhibitor of angiotensin II. It interacts with protein targets in the cell and blocks their function. Sar1,Ile8]-Angiotensin II is a research tool that can be used to study the interactions between proteins and inhibitors. Sar1,Ile8]-Angiotensin II has high purity and is not radioactive. It is also an antibody that can be used in life science research.Formula:C46H73N13O10Purezza:Min. 95%Peso molecolare:968.15 g/molFmoc-N-Amido-dPEG®12-Acid
CAS:Fmoc-N-Amido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purezza:Min. 95%Peso molecolare:839.96 g/molSuc-Ala-Ala-Pro-Phe-AMC
CAS:Suc-Ala-Ala-Pro-Phe-AMC is a peptide that is an activator of the acetylcholine receptor. Suc-Ala-Ala-Pro-Phe-AMC has been shown to inhibit the binding of the ligand to the receptor and also prevent activation of ion channels. It has been used as a research tool for studying protein interactions, as well as, antibody production and cell biology. This peptide can also be used as a pharmacological agent, which may be useful in treating diseases such as Alzheimer's disease.
Formula:C34H39N5O9Purezza:Min. 95%Peso molecolare:661.7 g/molAnti Secretin (Human) Serum (50 ul)
CAS:Anti-Secretin (Human) Serum is a purified protein that inhibits the activity of secretin, a peptide hormone. It is used as a research tool to study the effects of secretin on various cells and tissues. It can also be used as an inhibitor in receptor binding experiments. Anti-Secretin (Human) Serum has been shown to inhibit the activity of ion channels such as calcium channels and potassium channels. This product is highly purified and has a purity level of > 98%.Formula:C29H42N8O8Purezza:Min. 95%Peso molecolare:630.69 g/molMethionyl-Lysyl-Bradykinin (Human, Bovine)
CAS:Methionyl-Lysyl-Bradykinin is a peptide inhibitor that has been shown to inhibit the activity of protein kinase C (PKC). PKC is involved in a number of cellular functions, including the regulation of ion channels and the activation of other enzymes. Methionyl-Lysyl-Bradykinin can be used as an inhibitor in research tool experiments. It can also be used as an activator or ligand in receptor binding experiments. The high purity and specificity of this product make it suitable for use as a research reagent.Formula:C61H94N18O13SPurezza:Min. 95%Peso molecolare:1,319.6 g/molAzido-dPEG®12-NHS ester
CAS:Azido-dPEG®12-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C16H34N4O7Purezza:Min. 95%Peso molecolare:394.46 g/molm-dPEG®23-OH
CAS:m-dPEG®23-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, m-dPEG®23-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C47H96O24Purezza:Min. 95%Peso molecolare:1,045.25 g/molGalanin (Human)
CAS:Galanin is a peptide that belongs to the family of neuropeptides and is found in the endocrine system, the central and peripheral nervous systems. It has been shown to inhibit the release of acetylcholine in the central nervous system and interestingly in Alzheimer’s disease patients, hyperinervation of galanin fibres has been found. Galanin is also known to have a variety of physiological effects including inhibition of insulin release, stimulation of prolactin and growth hormone secretion and it also plays a role in feeding, mood, cognition, neuroendocrine regulation and affects gastrointestinal motility. Galanin asserts its effects through associated with G-protein coupled receptors. This product is available as a 0.5mg vial.
Formula:C139H210N42O43Purezza:Min. 95%Peso molecolare:3,157.4 g/molNeurokinin B (Human, Porcine, Bovine, Rat, Mouse)
CAS:As a member of the tachykinin neuropeptide family, Neurokinin B is involved in the dilation of blood vessels, the contraction of smooth muscles and the excitation of neurons. This product can be applied as a NK3 receptors selective agonist and is available as a 0.5mg vial.
Formula:C55H79N13O14S2Purezza:Min. 95%Peso molecolare:1,210.4 g/molCoV-2 N (196 a.a)
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019. The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans. While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The E. coli derived recombinant protein contains the Coronavirus 2019 middle region 196 a.a. from the nucleocapsid protein and fused to GST-6xHis tag at N-terminal and having a M.W. Of 48.4 kDa. It has been purified using PNTA Sepharose-Affinity Purification. The CoV-2 Nucleocapsid protein solution is supplied in 50mM Tris-HCl pH 8, 1M Urea, and 50% Glycerol.Purezza:Min. 95%H-YLEYRQVPV-OH
MAGE-A protein: MAGE-A p248V9, also kwon as multi-MAGE-A (YLEYRQVPV) is an epitope of Melanoma Antigen Gene expressed by tumors of different histological types and is a Cancer/Testis Antigens (CTA). Type of MAGE-A expressed in tumors cells varies according to the type of tumor. Targeting epitopes shared by all MAGE-A antigens would be interest in immunotherapy against a broad spectrum of cancers. Applications of MAGE-A p248V9 (multi-MAGE-A) : MAGE-A p248V9 is very useful because it could generate an HLA-A*02:01-restricted CTL response and shared by MAGE-A1,-A2,-A3,-A4,-A6,-A10 and -A12. MAGE-A p248V9 is used to stimulate specific cytotoxic T lymphocytes (CTL) in PBMCs and then to analyze CTL response especially the cytokine production by ELISPOT assay.Serum Thymic Factor
CAS:Serum thymic factor (STF) is a peptide that is secreted by the thymus gland. STF has been shown to inhibit the binding of lysosomal enzymes to their receptors in the presence of proteinase inhibitors. STF also activates complement C3 and C4, leading to the production of anaphylatoxins. This peptide has been used as a research tool for studying protein interactions and receptor-ligand interactions. Additionally, STF has been shown to be a ligand that binds to a receptor on human erythrocytes.
Formula:C33H54N12O15Purezza:Min. 95%Peso molecolare:858.85 g/molCBZ-N-Amido-dPEG®3-Amine
CAS:CBZ-N-Amido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CBZ-N-Amido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C25H53NO12Purezza:Min. 95%Peso molecolare:559.69 g/molZ-Val-Val-Arg-AMC
CAS:Z-Val-Val-Arg-AMC is a synthetic peptide that activates the glycine receptor. It has been shown to inhibit ion channel function in a rat model of epilepsy, and also to block the binding of an antibody against the glycine receptor. The peptide was synthesized by coupling L-valine, L-valylglycine, and L-arginine with methyl 2-(4'-methylaminophenyl) acetate. Z-Val-Val-Arg-AMC is a high purity product that has been shown to be useful in cell biology research as a tool for studying ligand/receptor interactions.
Formula:C34H45N7O7Purezza:Min. 95%Peso molecolare:663.76 g/molPACAP (Human, 6-38)
CAS:PACAP is a peptide that belongs to the class of activators. It is used as a research tool for its ability to activate ion channels in mammalian cells. PACAP interacts with receptors and can be found in both the central nervous system and peripheral tissues. The receptor for PACAP, known as the PAC1 receptor, is coupled to G-proteins and regulates adenylate cyclase activity. PACAP has been shown to inhibit cell proliferation and promote apoptosis in various types of cancer cells.
PACAP also stimulates the release of oxytocin from neurohypophysis cells, which may lead to its use as a treatment for autism spectrum disorders or depression.Formula:C182H300N56O45SPurezza:Min. 95%Peso molecolare:4,024.7 g/molm-dPEG®4-Tosylate
CAS:m-dPEG®4-Tosylate is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Tosylate is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C26H44N2O13Purezza:Min. 95%Peso molecolare:592.63 g/molNociceptin (Human)
CAS:Nociceptin is a peptide that binds to the NOP receptor and activates it, which inhibits neuronal activity. It has been shown to inhibit protein interactions by acting as an inhibitor of the enzyme proteasome. Nociceptin activates the Ligand-gated ion channels, which are involved in pain perception. Nociceptin also has been used as a research tool for investigating protein interactions and antibody production.
Formula:C79H129N27O22Purezza:Min. 95%Peso molecolare:1,809 g/molAmino-dPEG®4 Acid
CAS:Amino-dPEG®4 Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4 Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Purezza:Min. 95%Peso molecolare:265.3 g/molZ-Leu-Leu-Nva-H (aldehyde)
CAS:Z-Leu-Leu-Nva-H (aldehyde) is a peptide that has been used as an activator and an inhibitor of ion channels. It binds to the receptor site on the ion channel, which changes the flow of ions through the channel. This peptide has been shown to inhibit ligand binding and protein interactions. Z-Leu-Leu-Nva-H (aldehyde) is a high purity product that is available in bulk amounts.
Formula:C25H39N3O5Purezza:Min. 95%Peso molecolare:461.60 g/mol[Asn1,Val5]-Angiotensin II
CAS:[Asn1,Val5]-Angiotensin II is a peptide that is used as a research tool to study the effects of angiotensin II on ion channels, ligand-receptor interactions and protein interactions. It is also used as an antibody to measure the level of angiotensin II in cells. This peptide has been shown to be an activator of potassium channels and inhibits calcium channels. The high purity of this product makes it suitable for use in pharmacology and cell biology research.
Formula:C49H70N14O11Purezza:Min. 95%Peso molecolare:1,031.2 g/molMAL-dPEG®4-(m-dPEG®24)3
CAS:MAL-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C23H40N4O12Purezza:Min. 95%Peso molecolare:564.58 g/molZ-Gly-Phe
CAS:Z-Gly-Phe is a peptide that inhibits protein synthesis by binding to the reactive site of a pancreatic enzyme. This site is normally occupied by a hydrogen bond and the compound binds to it by occupying this space, resulting in the inhibition of enzyme activity. Z-Gly-Phe has been shown to inhibit insulin-stimulated glucose uptake in rats, which may be due to its ability to bind with sodium carbonate. The binding constants of Z-Gly-Phe and its inhibitors have been determined using an analytical method that measures changes in pH. The optimum pH for Z-Gly-Phe is 8.5, which corresponds with the optimal pH for human pancreatic enzymes.Formula:C19H20N2O5Purezza:Min. 95%Peso molecolare:356.37 g/molß-Alanyl-L-Histidine [Carnosine]
CAS:ß-Alanyl-L-Histidine is a dipeptide that is naturally occurring in the human body and is involved in many biochemical processes. It is a precursor of carnosine, which can be found in muscle and brain tissue. Carnosine has been shown to have antioxidant properties and has been used as a supplement for those who are at risk of developing diabetes. Carnosine supplementation has also been shown to improve exercise performance by increasing muscle strength and improving the function of muscle cells. ß-Alanyl-L-Histidine may also have metal chelate properties due to its ability to bind metals such as iron and copper.
Formula:C9H14N4O3Purezza:Min. 95%Peso molecolare:226.23 g/molFmoc-N-Amido-dPEG®4-NHS Ester
CAS:Fmoc-N-Amido-dPEG®4-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®4-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C30H36N2O10Purezza:Min. 95%Peso molecolare:584.24 g/molm-dPEG®-Acid (MW = 412)
CAS:m-dPEG®-Acid (MW = 412) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®-Acid (MW = 412) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Purezza:Min. 95%Peso molecolare:412.47 g/molAzido-dPEG®4-Alcohol
CAS:Azido-dPEG®4-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®4-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Purezza:Min. 95%Peso molecolare:219.24 g/molδ Sleep-Inducing Peptide (DSIP)
CAS:The Delta Sleep-Inducing Peptide (DSIP) is a neuropeptide which is found in plasma, peripheral organs and neurons. It has been found to induce delta sleep in mammals and have the ability to cross the blood-brain barrier as well as be absorbed from the gut. Studies have shown that DSIP plasma concentration and the human circadian rhythm are correlated and that DSIP concentrations are dependent on the initiation of sleep. DSIP has also demonstrated its ability to affect levels of hormones, neurotransmitters and psychological performance. In patients with schizophrenia and depression levels of DSIP in the cerebrospinal fluid and plasma were found to be lower compared to healthy controls. Clinically DFSIP has already been used to treat opioid and alcohol withdrawal in reducing symptoms felt by patients. This product is available as a 0.5mg vial.Formula:C35H48N10O15Purezza:Min. 95%Peso molecolare:848.81 g/mol[Tyr8]-Substance P (0.5 mg vial)
CAS:Substance P is a neuropeptide that is synthesized from the precursor protein pro-opiomelanocortin (POMC). Substance P has been shown to be a potent inhibitor of the synthesis of proteins that are necessary for cell division. It also stimulates the release of inflammatory mediators and has been shown to have an activator effect on receptors. This product is used as a research tool in cell biology, biochemistry, and pharmacology.
Formula:C63H98N18O14SPurezza:Min. 95%Peso molecolare:1,363.6 g/molAc-Asp-Asn-Leu-Asp-H (aldehyde)
CAS:Ac-Asp-Asn-Leu-Asp-H (aldehyde) is a peptide that is an agonist of the ion channels. It can be used as a research tool in studies on protein interactions and receptor pharmacology. Ac-Asp-Asn-Leu-Asp-H (aldehyde) binds to the ligand binding site of ion channels, which activates or inhibits their function. This peptide has been shown to inhibit the activity of potassium channels and glutamate receptors, and it can be used as an antibody for cell biology and immunology experiments.
Formula:C20H31N5O10Purezza:Min. 95%Peso molecolare:501.49 g/molBis-dPEG®13-NHS Ester
CAS:Bis-dPEG®13-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®13-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C38H64N2O21Purezza:Min. 95%Peso molecolare:884.92 g/molFmoc-N-Amido-dPEG®36-Acid
CAS:Fmoc-N-Amido-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C90H161NO40Purezza:Min. 95%Peso molecolare:1,897.22 g/molAmino-dPEG®12-OH
CAS:Amino-dPEG®12-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, amino-dPEG®12-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C24H51NO12Purezza:Min. 95%Peso molecolare:545.66 g/molAzido-dPEG®8-Acid
CAS:Azido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C72H146N4O35Purezza:Min. 95%Peso molecolare:1,627.94 g/molAmino-dPEG®4-(m-dPEG®8)3
CAS:Amino-dPEG®4-(m-dPEG®8)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®8)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C178H346N6O86Purezza:Min. 95%Peso molecolare:3,946.64 g/molArg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr-Ala-Ala-Arg-Gly
CAS:Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr-Ala-Ala-Arg-Gly is a peptide with the molecular formula C14H20N4O2. It is an inhibitor of protein interactions, activator of ligands and receptor, and has a CAS number of 2382-80-1. This product is used in research to study ion channels and antibodies.
Formula:C64H106N22O21•2CH3COOH•4H2Purezza:Min. 95%Peso molecolare:1,711.86 g/molDes-Arg9-Bradykinin
CAS:Des-Arg9-bradykinin is a peptide that is a potent activator of the B2 receptor. It is a potent inhibitor of ion channels, including Ca2+, K+ and Na+ channels. Des-Arg9-bradykinin has been used as a research tool in cell biology, particularly to investigate the role of bradykinins in signal transduction pathways. This chemical is highly purified and can be obtained from Sigma-Aldrich with CAS No. 15958-92-6.Formula:C44H61N11O10Purezza:Min. 95%Peso molecolare:904.02 g/mol4,7,8,9-Ac4-Neu5Troc(2→O)-O-C(CF3)=NPh Methyl Ester
CAS:4,7,8,9-Ac4-Neu5Troc(2→O)-O-C(CF3)=NPh Methyl Ester is a glycosylated peptide that is conjugated with an acetate ester. This compound is a member of the Acetyl Neu5Ac family of glycoconjugates that are found on the surface of cells and are involved in cell-cell interactions and immune responses. 4,7,8,9-Ac4-Neu5Troc(2→O)-O-C(CF3)=NPh Methyl Ester has been shown to inhibit bacterial growth by interfering with the synthesis of bacterial cell walls.
Formula:C29H32N2O14Cl3F3Purezza:Min. 95%Peso molecolare:795.92 g/molBoc-Leu-Ser-Thr-Arg-AMC
CAS:Boc-Leu-Ser-Thr-Arg-AMC is a fluorescent peptide used as a research tool to study protein interactions. It can be used to activate or inhibit ion channels. Boc-Leu-Ser-Thr-Arg-AMC is a high purity, water soluble peptide that has been purified by HPLC and characterized for its purity and integrity by mass spectrometry and amino acid analysis.Formula:C34H52N8O10Purezza:Min. 95%Peso molecolare:732.82 g/molGly-Gly
CAS:Gly-Gly is a natural compound that belongs to the group of esters. It has been shown to have an antioxidative effect in vitro and in vivo. Gly-Gly has been shown to inhibit the growth of carcinoma cells by binding with hydrogen bonding interactions, which leads to cell death. This compound also has a strong antibacterial efficacy against Gram-positive bacteria, such as methicillin-resistant Staphylococcus aureus (MRSA). In addition, gly-gly has been shown to be effective against Mycobacterium tuberculosis and Mycobacterium avium complex. This compound may be useful for treating infectious diseases caused by Gram-positive bacteria such as MRSA or methicillin resistant Staphylococcus aureus (MRSA).Formula:C4H8N2O3Purezza:Min. 95%Peso molecolare:132.12 g/molDNP-dPEG®4-Acid
CAS:DNP-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DNP-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C18H36O9Purezza:Min. 95%Peso molecolare:396.47 g/molHis-Leu
CAS:His-Leu is a signal peptide that contains the amino acid sequence His-Leu. It is used in a variety of diagnostic tests and has been shown to bind to the p-hydroxybenzoic acid inhibitor binding site on the enzyme histone H1. This peptide has also been shown to inhibit the activity of histone H1 enzymes, which are involved in the regulation of DNA replication and transcription. In addition, His-Leu has been shown to inhibit specific enzymes that regulate human serum albumin synthesis, such as preparative high performance liquid chromatography (Hplc) and terminal residues. His-Leu can be used for diagnosis or as an inhibitor for infectious diseases.
Formula:C12H20N4O3Purezza:Min. 95%Peso molecolare:268.31 g/molPlatelet Factor-4 (Human, 58-70)
CAS:Platelet Factor-4 (PF4) is an activator of G protein coupled receptors that belongs to the group of peptides. PF4 binds to the CXCR1 receptor and activates it, which causes a change in the ion channels. It has been shown that PF4 can activate other G protein coupled receptors such as CXCR2 and CXCR3. This protein is used in research as a ligand for antibody production or as a research tool for studying the interactions between proteins. Platelet Factor-4 has been shown to inhibit ATPase activity in cell membranes and may be useful in pharmacological studies.Formula:C76H133N17O18Purezza:Min. 95%Peso molecolare:1,573 g/molCGRP (Rat)
CAS:CGRP (Rat) product with the disulfide Bonds: Cys2-Cys7 and available as a 0.5mg vial. CGRP is the calcitonin gene-related peptide (CGRP), a neuropeptide that plays an important role in the regulation of vascular tone and blood flow, as well as pain perception, inflammation, and neurogenic inflammation. It is a potent vasodilator and has been implicated in a wide range of physiological and pathophysiological processes.
This product has the potential for use in the study of the physiological and pathological roles of CGRP and to investigate the effects of CGRP on blood vessels, neurons, and other tissues. It has also been used to develop models of migraine headaches and other conditions associated with CGRP dysfunction.Purezza:Min. 95%BNP Human
BNP Human is a peptide with a molecular weight of 5.5 kDa. It is the human form of brain natriuretic peptide (BNP) and is used for research purposes in cell biology, immunology, pharmacology, and life science. BNP Human is an activator of ion channels and inhibits protein interactions. BNP Human has been shown to have effects on receptors and ligands. It has CAS number: 60714-06-2.Purezza:Min. 95%SPDP-dPEG®36-Acid
CAS:SPDP-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C83H158N2O39S2Purezza:Min. 95%Peso molecolare:1,872.26 g/molH-SLFLGILSV-OH
CD20 (188-196) is a short part of a membrane phosphoprotein, CD20, which is expressed on the surface of B cells. CD20 receptor is an important target for immunotherapy against B cell lymphoma. CD20 epitopes are used in antibodies CD20 production, such as the production of the first monoclonal antibody to be approved for the treatment of lymphoma.
Applications of CD20 (188-196):
CD20 (188-196) is involved in research to generate cytotoxic T lymphocytes and stimulate CTL responses against B cell diseases. The production of specific T cells and IFN-γ are quantified by ELISPOT. CD20 (188-196) has been identified as a highly immunogenic HLA-A2 restricted peptide. Results suggest that CD20 (188-196) may serve in immunotherapeutic strategies especially for vaccine development against certain type of blood cancer.
CD20 (188-196) is also used in research on cell therapy as target for T cell receptor. In fact, T cells are modified in vivo to express specific T cell receptor and then inject modified cells in B cells cancer patient in order to recognized malignant B cells and treat them.PDGF BB Human
PDGF BB is a cytokine that is produced by macrophages and fibroblasts in response to an immune stimulus. PDGF BB signals through the PDGF receptor and has been shown to be involved in the development of atherosclerosis. Cytokines are also proteins that are released by cells as a response to an external stimulus and can promote cell growth, differentiation, or suppress cell death. Cytokines play a role in the inflammatory process, regulation of immune responses, and other biological processes. Cytokine production is regulated by various factors including cytokine receptors, cytokine synthesis, gene expression, and post-translational modifications. Escherichia coli (E. coli) is a bacterium that belongs to the family Enterobacteriaceae and causes infection in humans. E. coli can produce toxins that cause diarrhea or other symptoms of food poisoning in humans. Cytokines have been shown to regulate E. coli growth
Purezza:Min. 95%4-Formyl-Benzamido-dPEG®12-TFP Ester
4-Formyl-Benzamido-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 4-Formyl-Benzamido-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C41H59F4NO16Purezza:Min. 95%Peso molecolare:897.9 g/molMannose Binding Lectin Light Tryptic Peptide Standard (4 nmol)
Mannose binding lectin is a host defense protein which has the ability to recognize a variety of infectious agents. This Mannose Binding Lectin Light Tryptic Peptide Standard can be used in protein identification and quantitation studies.Purezza:Min. 95%Brazzien (2-54)
Brazzien (2-54) is a peptide that binds to the extracellular domain of the human receptor for Advanced Glycation Endproducts (RAGE). This receptor plays an important role in many cellular processes, including tissue damage and inflammation. Brazzien (2-54) is a potent inhibitor of RAGE activity and has been shown to inhibit the binding of RAGE ligands to RAGE.Purezza:Min. 95%Substance P (Human, Bovine, Rat, Mouse)
CAS:Substance P is a member of the tachykinin neuropeptide family which is produced in the central nervous system (CNS) and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.Formula:C63H98N18O13S•3CH3COOH•5H2OPurezza:Min. 95%Peso molecolare:1,617.84 g/mol
