Amyloid beta-Protein (1-40) hydrochloride salt

CAS: 131438-79-4

Ref. 3D-FA109545

Product Information

• Name: Amyloid beta-Protein (1-40) hydrochloride salt
• Synonyms: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala -Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
• Brand: Biosynth
• Description: Amyloid beta-protein (1-40) hydrochloride salt H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln is a secretase inhibitor that binds to the active site of the enzyme and blocks its activity. Amyloid beta protein (1 - 40) hydrochloride salt H has been shown to inhibit the production of amyloid, which is linked to Alzheimer's disease. The amino acid sequence of this compound is identical to that of the human amyloid beta protein. The inhibition of enzymes such as aspartyl proteases, metalloproteases, and serine proteases may be responsible for its therapeutic effects in metabolic disorders.

Chemical properties

• Molecular weight: 4,329.81 g/mol
• Formula: C₁₉₄H₂₉₅N₅₃O₅₈S
• Purity: Min. 95%