Product Information
Name:Teduglutide
Synonyms:
- H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Al a-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
- [Gly2]-GLP-2 (human) HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Brand:Biosynth
Description:Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:3,752.16 g/mol
Formula:C164H252N44O55S
Purity:Min. 95%
Technical inquiry about: Teduglutide
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
