Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.129 produtos)
- Por Alvo Biológico(99.160 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.742 produtos)
- Metabólitos secundários(14.222 produtos)
Foram encontrados 130579 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Biotin-Angiotensin I/II (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H76N14O13SPeso molecular:1,125.33 g/molBAM-18P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C107H148N30O26S2Peso molecular:2,334.69 g/mol[D-His26]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C189H285N55O57S1Peso molecular:4,271.67 g/molUremic Pentapeptide (U5-Peptide)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C32H48N8O9Peso molecular:688.8 g/molARQ 531
CAS:<p>ARQ 531 is a small molecule inhibitor specifically designed to target Bruton's tyrosine kinase (BTK), which is a type of enzymatic protein. This compound is meticulously developed within a laboratory setting to disrupt key pathways involved in cancer cell survival. Its mode of action involves the selective and reversible inhibition of BTK, thereby obstructing signal transduction that promotes malignant cell proliferation and survival.</p>Fórmula:C25H23ClN4O4Pureza:Min. 95%Peso molecular:478.93 g/molFibronectin Type III Connecting Segment (1-25)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C123H195N31O39Peso molecular:2,732.04 g/mol[Tyr22]-a-CGRP (22-37), rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C82H120N20O25Peso molecular:1,785.99 g/mol(Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C145H210N42O45Pureza:Min. 95%Peso molecular:3,261.47 g/mol(Leu16)-Amyloid b-Protein (16-19)
CAS:<p>(Leu16)-Amyloid b-Protein (16-19) is the carboxyl-terminal peptide of amyloid b protein, a component of the amyloid plaques that are found in Alzheimer's disease. The sequence is found in the blood and cerebrospinal fluid of healthy individuals as well as those with Alzheimer's disease. The peptide is a tetrapeptide that is cleaved from the full length protein by hydrogenolysis. This peptide can also be synthesized by condensation of an activated amino group and an esterified l-phenylalanine. The carboxyl group at position 16 can be removed using carbodiimide to produce a lysine residue.</p>Fórmula:C26H42N4O5Pureza:Min. 95%Peso molecular:490.64 g/molBiotin-Neuromedin B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H87N17O14S2Peso molecular:1,358.62 g/molHerpes Virus Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H64N10O14Peso molecular:920.46 g/molHC-067047
CAS:<p>HC-067047 is an experimental drug that has been shown to decrease the intracellular Ca2+ concentration in various cell types, including neurons. This agent also inhibits the influx of Ca2+ ions through voltage-gated channels and blocks the release of Ca2+ from intracellular stores. HC-067047 is being investigated for chronic cough as it has been shown to reduce this symptom in a guinea pig model of asthma. In vitro studies have shown that HC-067047 is not active against protozoa or bacteria but does inhibit the growth of tumor cells. The mechanism of action for HC-067047 is not fully elucidated, but it may act by inhibiting ion transport proteins such as TRPV4, Toll-like receptor, or Ryanodine receptor. HC-067047 has also been found to increase MMP9 activity and inhibit production of cytokines such as IL-6 and TNFα.</p>Fórmula:C26H28F3N3O2Pureza:Min. 95%Peso molecular:471.51 g/molRosuvastatin
CAS:<p>Rosuvastatin is a synthetic lipid-lowering agent, which is a product of pharmaceutical manufacturing derived from extensive research in cardiovascular pharmacology. It functions as an HMG-CoA reductase inhibitor, effectively blocking the enzyme responsible for cholesterol biosynthesis in the liver. By inhibiting this enzyme, Rosuvastatin reduces the production of cholesterol, especially low-density lipoprotein (LDL) cholesterol, which is known to contribute to atherosclerosis.</p>Fórmula:C22H28FN3O6SPureza:Min. 95%Peso molecular:481.54 g/molP38 MAP Kinase Inhibitor IV
CAS:<p>Phenol,2,2'-sulfonylbis[3,4,6-trichloro] is a sulfate-containing compound that has been shown to stimulate the immune system and activate mitogen-activated protein kinases (MAPKs) in mosquitoes. The inclusion of this substance in vaccines may lead to increased immunity against various diseases. Phenol,2,2'-sulfonylbis[3,4,6-trichloro] has also been shown to reduce cancer cell proliferation by modulating antigen-presenting cells and inducing apoptosis in ovarian cancer cells. This substance can be used as a cost-effective alternative to dextran sulfate for generating pluripotent stem cells from adult cells and can also be used as a scalable process for generating pluripotent cells from human amniotic fluid.</p>Fórmula:C12H4Cl6O4SPureza:Min. 95%Peso molecular:456.94 g/molFmoc-Ile-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ile-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Z-His(Bzl)-OH
CAS:<p>Please enquire for more information about Z-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H21N3O4Pureza:Min. 95%Peso molecular:379.41 g/molIsocyanomethyl resin (200-400 mesh)
<p>Please enquire for more information about Isocyanomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Cor e Forma:PowderOctreotide trifluoroacetate salt (Dimer, Antiparallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Antiparallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C98H132N20O20S4Pureza:Min. 95%Peso molecular:2,038.48 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H73N13O10Peso molecular:980.20 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C56H73N13O26Pureza:Min. 95%Peso molecular:1,344.25 g/mol(Cyclo(Glu22-Lys26),Leu27)-pTH (1-31) amide (human)
CAS:<p>Please enquire for more information about (Cyclo(Glu22-Lys26),Leu27)-pTH (1-31) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C162H267N49O45S2Pureza:Min. 95%Peso molecular:3,685.29 g/molCalmodulin-Dependent Protein Kinase II (290-309)
CAS:<p>Calmodulin-dependent protein kinase II (CAMKII) is a calcium/calmodulin-dependent enzyme that plays an important role in the regulation of cardiac contractility. CAMKII is activated by the binding of beta-adrenergic and other hormones to their receptors on the plasma membrane, leading to a change in the membrane potential. CAMKII then phosphorylates myofibrils, which leads to an increase in cardiac contractility. In liver cells, CAMKII activation leads to an increase in contractility and perfusion through increased ethylene production.</p>Fórmula:C103H185N31O24SPureza:Min. 95%Peso molecular:2,273.83 g/molc11 Bodipy 581/591
CAS:<p>C11 Bodipy 581/591 is an inhibitor used in cancer research to study the effects of protein kinase inhibitors on tumor cells. This fluorescent analog is used to track the activity of cyclin-dependent kinases, which are involved in cell cycle regulation and apoptosis. C11 Bodipy 581/591 has been shown to be effective at inhibiting the growth of human cancer cells and inducing apoptosis. It is also used as an anticancer agent in Chinese medicine. This inhibitor can be detected in urine samples, making it a valuable tool for non-invasive cancer diagnosis and monitoring. Overall, C11 Bodipy 581/591 is a promising compound for cancer research due to its potent inhibitory effects on cancer cell growth and proliferation.</p>Fórmula:C30H35BF2N2O2Pureza:Min. 95%Peso molecular:504.4 g/molACY-775
CAS:<p>ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.</p>Fórmula:C17H19FN4O2Pureza:Min. 95%Peso molecular:330.36 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C184H277N51O56SPureza:Min. 95%Peso molecular:4,131.54 g/molBiotinyl-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C213H325N57O62S2Pureza:Min. 95%Peso molecular:4,740.34 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C35H40N4O7Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:628.71 g/molSU086
CAS:<p>Chalcone compound that decreases HSP90 levels and inhibits prostate cancer cell growth and migration in vitro</p>Fórmula:C18H17NO6Peso molecular:343.33 g/molH-D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2 (Disulfide bond between Cys2 and Pen7)
CAS:<p>H-D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2 is a neuropeptide that was found in the brain of an amphibian and has been shown to have antinociceptive properties. The peptide has been shown to bind to kappa opioid receptors and δ opioid receptors, which are both involved in pain regulation. H-D-Phe-Cys-Tyr-D-Trp-Orn (HDFYDT) has been shown to be effective in vivo, which may be due to its ability to increase striatal dopamine levels and decrease locomotor activity. HDFYDT also increases gamma aminobutyric acid levels in the brain, which may result in reduced anxiety. HDFYDT is synthesized from two amino acids: histidine and glutamine. This peptide is sensitive to proteolytic enzymes and can be degraded into smaller fragments such</p>Fórmula:C50H67N11O11S2Pureza:Min. 95%Peso molecular:1,062.27 g/molCl4H6
CAS:<p>Cl4H6 is a medicinal compound that has shown promising results in inhibiting kinases, which are enzymes involved in the growth and proliferation of cancer cells. This anticancer agent has been tested on human tumor cell lines and has demonstrated its ability to induce apoptosis or programmed cell death in these cells. Cl4H6 is a potent inhibitor of protein kinases and may have potential therapeutic applications for cancer treatment. It is also an analog of Chinese herbal medicine compounds found in urine samples with similar anticancer properties. The use of Cl4H6 as a kinase inhibitor holds great promise for the development of novel cancer therapies.</p>Fórmula:C59H113NO5Pureza:Min. 95%Peso molecular:916.5 g/molβ-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C25H47N5O6SPeso molecular:545.75 g/molBiotin-Kinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/mol(Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C46H83N13O14Pureza:Min. 95%Peso molecular:1,042.23 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C195H300N54O56SPureza:Min. 95%Peso molecular:4,328.86 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C47H73N11O16SPureza:Min. 95%Peso molecular:1,080.21 g/molMyosin Kinase Inhibiting Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H78N18O11Peso molecular:987.2 g/molPrepro-adrenomedullin (153-185), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C143H224N42O43Peso molecular:3,219.56 g/mol(Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C193H293N53O58SPureza:Min. 95%Peso molecular:4,315.78 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C50H78N14O19Pureza:Min. 95%Peso molecular:1,179.24 g/molSAR125844
CAS:<p>SAR125844 is a potent inhibitor of the tyrosine kinase activity of epidermal growth factor receptor (EGFR). It has been shown to inhibit tumor growth in animal models and inhibit cell proliferation in cancer cells. SAR125844 has been evaluated in clinical studies for the treatment of patients with prostate cancer, which is resistant to imatinib. The drug was found to be safe and well tolerated at doses up to 800 mg/day. Clinical response rates were observed in some patients who had experienced disease progression while on other therapies. SAR125844 inhibits tumor growth by targeting EGFR, which is an important cellular pathway that promotes cell proliferation and survival.</p>Fórmula:C25H23FN8O2S2Pureza:Min. 95%Peso molecular:550.63 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C195H300N56O56SPureza:Min. 95%Peso molecular:4,356.88 g/molFITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I)
CAS:<p>Please enquire for more information about FITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C62H67N11O20SPureza:Min. 95%Peso molecular:1,318.32 g/molAzilsartan medoxomil
CAS:<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Fórmula:C30H24N4O8Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:568.53 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-Lys(Dnp) amide ammonium salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) amide ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C68H89N15O26Pureza:Min. 95%Peso molecular:1,532.52 g/molHypoxanthine-13C2,15N
CAS:<p>Hypoxanthine-13C2,15N is an inhibitor that has been used in Chinese medicine to treat a variety of ailments. It is an analog of hypoxanthine, a naturally occurring substance found in urine. Hypoxanthine-13C2,15N has been shown to inhibit the production of calcitonin, a hormone produced by the thyroid gland that regulates calcium levels in the blood. It also inhibits the activity of kinases, enzymes that play a role in cell division and growth. Studies have shown that hypoxanthine-13C2,15N can induce apoptosis (programmed cell death) in cancer cells, making it a potential treatment for various types of tumors. Additionally, this substance has been found to inhibit the activity of oxytocin and galanin, two neuropeptides involved in various physiological processes. Overall, hypoxanthine-13C2,15N shows promising potential as a therapeutic agent for cancer and other diseases</p>Fórmula:C5H4N4OPureza:90%Peso molecular:139.09 g/molOrforglipron
CAS:<p>Orforglipron is a non-peptide, small-molecule drug. It is a GLP-1 receptor agonist used to treat type 2 diabetes and obesity.</p>Fórmula:C48H50F2N10O5Pureza:Min. 95%Peso molecular:885 g/molc18:1 Ceramide (d17:1/18:1(9Z))
CAS:<p>C18:1 Ceramide (d17:1/18:1(9Z)) is a sphingolipid, which is originally sourced from plant or synthetic lipid precursors. Ceramides are integral components of the cellular lipid bilayer and are crucial for maintaining the integrity and function of the skin barrier. Their mode of action involves participating in cell signaling pathways that regulate cellular differentiation, proliferation, and apoptosis.</p>Fórmula:C35H67NO3Pureza:Min. 95%Peso molecular:549.91 g/mol[Val5,Asn9]-Angiotensin I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molDynorphin A (2-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H117N23O13Peso molecular:1,440.81 g/molGW 0742
CAS:<p>Peroxisome proliferator-activated receptor PPARβ/ÎŽ agonist</p>Fórmula:C21H17F4NO3S2Pureza:Min. 95%Peso molecular:471.49 g/molCarassin (Carrassius Auratus)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/molAtorvastatin sodium
CAS:<p>HMG-CoA reductase antagonist</p>Fórmula:C33H35FN2O5•NaPureza:Min. 95%Cor e Forma:PowderPeso molecular:581.63 g/molHypertrehalosaemic Neuropeptide, Nauphoeta cinerea
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H67N13O14Peso molecular:1,074.19 g/molA-A-A-Y-G-G-F-L
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C37H52N8O10Peso molecular:768.87 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C104H159N29O31Peso molecular:2,311.60 g/molAmyloid P Component (33-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C37H56N10O7SPureza:Min. 95%Peso molecular:784.97 g/molCC Chemokine Receptor 3 Fragment I, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C142H223N35O53S2Peso molecular:3,332.68 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C48H71N13O15Peso molecular:1,070.18 g/molSomatostatin-14 (3-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C71H96N16O17S2Peso molecular:1,509.78 g/molα-Bag Cell Peptide (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H67N13O9Peso molecular:922.11 g/molCalpain inhibitor XII
CAS:<p>Inhibitor of calpain, a calcium-dependent cysteine protease which is implicated in the calcium-mediated processes such as apoptosis and neuronal membrane excitability. Calpain inhibitor XII has antiviral properties as it can inhibit the main protease Mpro (3CLpro) from SARS-CoV-2 with IC50 of 0.45 μM.</p>Fórmula:C26H34N4O5Pureza:Min. 95%Cor e Forma:PowderPeso molecular:482.57 g/mol4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol
CAS:<p>4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol is a potent inhibitor of kinases and proteins in humans that has been shown to have anti-cancer properties. It is an analog of neopterin, a biomarker for immune activation and oxidative stress. This compound has been found to induce apoptosis in cancer cells and inhibit the growth of tumors. The 4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol inhibitor has also been shown to be effective against Chinese hamster ovary cells and various other kinases. In addition, it has potential therapeutic applications as an anticancer agent due to its ability to inhibit the proliferation of cancer cells. This compound can also be detected in urine samples and may serve as a useful diagnostic tool for certain diseases or conditions.</p>Fórmula:C8H8N4O3SPureza:Min. 95%Cor e Forma:PowderPeso molecular:240.24 g/molVA-β-MSH, Lipotropin-γ, Proopiomelanocortin - derived
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H188N36O37SPeso molecular:2,831.19 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H37N5O7SPeso molecular:587.70 g/molBremelanotide
CAS:<p>Bremelanotide is a synthetic cyclic peptide, classified as a melanocortin receptor agonist. It is derived from the analogs of the alpha-melanocyte-stimulating hormone (α-MSH), with its origins in melanocortin system research. This product acts primarily through the activation of melanocortin 4 receptor (MC4R) pathways in the central nervous system.Bremelanotide exerts its physiological effects by stimulating these receptors, leading to increased neural signals related to sexual arousal and desire. The melanocortin receptors, especially MC4R, play a significant role in modulating various neural networks involved in sexual function.This compound is utilized primarily for the treatment of hypoactive sexual desire disorder (HSDD) in premenopausal women. By enhancing sexual desire and arousal, Bremelanotide provides a therapeutic option for individuals experiencing clinically significant distress related to low sexual desire. Its application in clinical settings highlights the potential of melanocortin pathways as therapeutic targets beyond their established roles in pigmentary and energy balance modulation.</p>Fórmula:C50H68N14O10Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:1,025.16 g/molAc-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H147N29O24SPeso molecular:2,135.50 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C81H126N26O21S2Peso molecular:1,864.2 g/mol1,2-Distearoyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>Fórmula:C44H88NO8PPureza:Min. 95%Peso molecular:790.15 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C191H291N53O56SPureza:Min. 95%Peso molecular:4,257.74 g/molMelittin trifluoroacetate
CAS:<p>Melittin is a peptide that is cationic and polycationic. It has been shown to be effective against mutants, such as those resistant to the antibiotic ampicillin. Melittin also has been shown to have a role in the development of vaccines for Brucella and typhimurium. The peptide has been shown to be effective against type species of these bacteria, such as Salmonella typhimurium and Brucella abortus. The mechanism of action of melittin is not fully understood but it may work by binding to the cell membrane, which causes ion leakage and consequently disrupts cellular functions.</p>Fórmula:C131H228N38O32Pureza:Min. 95%Cor e Forma:PowderPeso molecular:2,847.45 g/mol4A/4B, 5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H73N11O22S3Peso molecular:1,264.38 g/molAc-Ser-Asp-Lys-Pro-OH
CAS:<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Fórmula:C20H33N5O9Pureza:Min. 95%Peso molecular:487.5 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Produto Controlado<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C11H11NO2·C12H23NPureza:Min. 95%Peso molecular:370.53 g/molProsaptide 769P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C114H194N28O35SPeso molecular:2,548.98 g/molDok-4 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H101N21O18Peso molecular:1,524.72 g/molLY 294002
CAS:<p>First generation PI 3-kinase inhibitor</p>Fórmula:C19H17O3NPureza:Min. 95%Cor e Forma:White To Off-White SolidPeso molecular:307.12084Lys-Bradykinin-Ser-Val-Gln-Val-Ser
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H121N23O20Peso molecular:1,688.96 g/molPancreatic Polypeptide (31-36) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H61N13O8Peso molecular:804 g/molOltipraz metabolite M2
CAS:<p>Oltipraz metabolite M2 is a pharmacologically active compound, which is derived from the metabolism of Oltipraz, a well-known chemopreventive agent. This metabolite is produced through hepatic biotransformation processes and plays a critical role in mediating the biological effects associated with its parent compound.</p>Fórmula:C10H12N2S2Pureza:Min. 95%Peso molecular:224.4 g/molNecrofibrin, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H112N16O25Peso molecular:1,541.73 g/molChorionic Gonadotropin-β(109-119) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H76N16O21SPeso molecular:1,269.31 g/molVX 702
CAS:<p>p38 MAP kinase antagonist</p>Fórmula:C19H12F4N4O2Pureza:Min. 95%Cor e Forma:SolidPeso molecular:404.32 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H81N21O17Peso molecular:1,236.32 g/molCEA Related, QYSWFVNGTF
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H77N13O16Peso molecular:1,248.37 g/molBudralazine
CAS:<p>Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.</p>Fórmula:C14H16N4Pureza:Min. 95%Peso molecular:240.3 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C22H36N8O11Peso molecular:588.58 g/mol[Tyr0] Gastric Inhibitory Peptide (23-42), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C119H182N34O31Peso molecular:2,584.92 g/molMBP (90-106), phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C89H141N25O22Peso molecular:1,913.27 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C56H80N12O14Peso molecular:1,145.3 g/molICG 001
CAS:<p>Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin</p>Fórmula:C33H32N4O4Pureza:Min. 95%Peso molecular:548.63 g/molBoc-Gly-Gly-Phe-Gly-OH
CAS:<p>Please enquire for more information about Boc-Gly-Gly-Phe-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H28N4O7Pureza:Min. 95%Cor e Forma:SolidPeso molecular:436.46 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H137N25O35Peso molecular:2,045.16 g/molTegoprazan
CAS:<p>Tegoprazan is an anti-gastric acid drug that is a proton pump inhibitor. It inhibits the production of gastric acid by inhibiting the H+, K+-ATPase enzyme (proton pump) in the gastric mucosa cells. Tegoprazan has dose-dependent effects and can be used for long-term treatment of diseases such as peptic ulcer, gastroesophageal reflux disease, and Zollinger-Ellison syndrome. Tegoprazan does not show any serious side effects, but it may cause some adverse reactions, such as drug reactions or increased risk for developing stomach cancer. Tegoprazan also has antiplatelet properties and can be used to prevent blood clot formation in patients after coronary artery bypass grafting surgery.</p>Fórmula:C20H19F2N3O3Pureza:Min. 95%Peso molecular:387.4 g/molVIP-Lys(Biotin), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C163H263N47O46S2Peso molecular:3,681.33 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Urolithin M7
CAS:<p>Urolithin M7 is a metabolite, which is derived from the transformation of ellagitannins, compounds found predominantly in pomegranates, berries, and nuts. This transformation occurs via intestinal microbiota, which convert ellagitannins into various urolithins, including Urolithin M7. Its mode of action involves influencing cellular processes, potentially modulating mitochondrial function and autophagy pathways. The action mechanisms are being explored for their roles in enhancing cell viability and metabolic health.</p>Fórmula:C13H8O5Pureza:Min. 95%Peso molecular:244.2 g/molFatty Acid Binding Protein (FABP), Highly Purified
<p>Fatty Acid Binding Protein (FABP), Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Fatty Acid Binding Protein (FABP), Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Pureza:≥95% By Sds-Page.β-Amyloid (10-20)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C71H99N17O16Peso molecular:1,446.68 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H77N13O12SPeso molecular:988.22 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H71N13O14S2Peso molecular:1,046.24 g/molGSK3 Peptide Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C470H76N16O16Peso molecular:1,121.23 g/molβ II probe
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C94H150N26O31SPeso molecular:2,172.46 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C205H340N60O53Peso molecular:4,493.37 g/molADP-Ribosylation Factor 1, ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C85H131N21O21Peso molecular:1,783.12 g/molInterleukin II (60-70)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C68H104N14O14SPeso molecular:1,373.74 g/molEpidermal Mitosis Inhibiting Pentapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C19H27N5O12Peso molecular:517.45 g/molAntho-Rwamide II
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C30H44N10O6Peso molecular:640.79 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C58H99N19O18S2Peso molecular:1,414.67 g/molFa-Gly-Leu-Ala-OH
CAS:<p>Fa-Gly-Leu-Ala-OH is a peptide sequence that is a potent activator of the glycine receptor. When administered, it causes the opening of ligand-gated ion channels, leading to an influx of ions and the depolarization of neurons. This peptide has been used as a research tool in studies on glycine receptors and cell biology. It can also be used as an inhibitor in studies on ion channels.</p>Fórmula:C18H25N3O6Pureza:Min. 95%Peso molecular:379.4 g/molRetatrutide acetate
CAS:<p>Acetate salt; GLP-1, GIP, and GCGR2 mimic; Obesity research</p>Fórmula:C221H342N46O68•(C2H4O2)xPeso molecular:4,791.38 g/molZ-Ile-Val-OH
CAS:<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C19H28N2O5Pureza:Min. 95%Peso molecular:364.44 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H59N11O8Peso molecular:858.02 g/molGPC3 (298-306), mouse
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H81N9O18Peso molecular:1,108.26 g/molSarafotoxin S6d
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H167N27O34S5Peso molecular:2,596 g/molSubstance P reversed sequence
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H98N18O13SPeso molecular:1,347.66 g/molBiotin-a-CGRP (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C173H281N53O51S2Peso molecular:4,015.69 g/molZ-Leu-Tyr-chloromethylketone
CAS:<p>Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.</p>Fórmula:C24H29ClN2O5Pureza:Min. 95%Peso molecular:460.95 g/molKinase Domain of Insulin Receptor (3)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H108N19O27Peso molecular:1,702.77 g/mol4A/4B, Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H100N16O25S2Peso molecular:1,593.76 g/molβ-Amyloid (13-27)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C84H126N24O24Peso molecular:1,856.09 g/molCaspase 2 Substrate 1m (ICH-1), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H44N6O12Peso molecular:716.8 g/molFmoc-N-Me-D-Arg(Mtr)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C32H38N4O7SPureza:Min. 95%Peso molecular:622.73 g/molZM 241385
CAS:<p>A2A adenosine receptor antagonist</p>Fórmula:C16H15N7O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:337.34 g/molAc-a-CGRP (19-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C88H139N25O26Peso molecular:1,963.24 g/molMethotrexate disodium
CAS:<p>Methotrexate is a drug that suppresses the immune system by inhibiting the production of white blood cells. It is used in the treatment of a number of diseases, including some cancers and autoimmune diseases such as rheumatoid arthritis and psoriasis. Methotrexate is metabolized to its active form, methotrexate, by an enzyme called dihydrofolate reductase (DHFR). The DHFR inhibitor activity of methotrexate blocks the synthesis of folate-dependent enzymes and prevents DNA synthesis in rapidly dividing cells. Methotrexate has been used in combination with other drugs to treat cancer. Methotrexate has also been shown to have antifungal properties against opportunistic fungal infections.</p>Fórmula:C20H20N8Na2O5Pureza:Min. 95%Cor e Forma:PowderPeso molecular:498.4 g/molZ-Ile-His-OH
CAS:<p>Please enquire for more information about Z-Ile-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H26N4O5Pureza:Min. 95%Peso molecular:402.44 g/molRG 7388
CAS:<p>Inhibitor of MDM2 E3 ubiquitin-protein ligase and MRP1 transporter</p>Fórmula:C31H29Cl2F2N3O4Pureza:Min. 95%Cor e Forma:White To Light (Or Pale) Yellow SolidPeso molecular:616.48 g/molBoc-Gly-Arg-OH
CAS:<p>Please enquire for more information about Boc-Gly-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H25N5O5Pureza:Min. 95%Peso molecular:331.37 g/molBiotin-LC-Protein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C69H121N25O18SPeso molecular:1,621 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>Fórmula:C26H38N8O7Pureza:Min. 95%Peso molecular:574.63 g/molN-α-Benzoyl-L-argininamide
CAS:<p>N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.</p>Fórmula:C13H19N5O2Pureza:Min 98%Cor e Forma:White PowderPeso molecular:277.32 g/molβ-Amyloid (11-22)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H102N18O18Peso molecular:1,483.70 g/molα-Conotoxin GI
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H76N20O18S4Peso molecular:1,433.63 g/molEndothelin-1 (1-15), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H108N16O24S5Peso molecular:1,718.02 g/molPAF (C16)
CAS:<p>PAF, short for Platelet-activating factor, is a mediator of platelet aggregation and a ligand for PAF receptors. It has roles in many other leukocyte functions around inflammation and immune response, as well as, chemotaxis and vasuclar changes. The PAF signaling system can trigger significant inflammatory and thrombotic cascades, and has been show to have roles in septic shock.</p>Fórmula:C26H54NO7PPureza:Min. 95%Peso molecular:523.68 g/mol1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>Fórmula:C28H56NO7PPureza:Min. 95%Peso molecular:549.72 g/molCalcium/Calmodulin Dependent Protein Kinase II-g (345-358)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C58H107N21O22Peso molecular:1,450.63 g/mol[Trp11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C80H122N22O19Peso molecular:1,696 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C164H278N58O45S4Peso molecular:3,910.64 g/molCathelicidin LL 37
CAS:<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>Fórmula:C205H340N60O53Pureza:Min. 95%Peso molecular:4,493.27 g/molAc-Adhesin (1025-1044) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H160N26O32Peso molecular:2,202.51 g/molβ-Amyloid Protein Precursor (657-676)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C95H152N30O31Peso molecular:2,210.45 g/molDynorphin A (2-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C90H146N30O21Peso molecular:1,984.36 g/molBRD6688
CAS:<p>BRD6688 is a protein inhibitor that binds to and inhibits the activity of GABA transporters. It is a potent inhibitor of the gaba transporter (GAT) with an IC50 of 0.2 μM. BRD6688 has been shown to inhibit the acetylation of histone proteins, which are important for transcriptional regulation and gene expression. BRD6688 also has a thermodynamic inhibitory constant (Ki) of 1.4 μM and a kinetic inhibitory constant (Ki) of 0.3 μM, indicating that it binds tightly to GATs and does not dissociate easily from it. The Ki values were determined by measuring the inhibition of GAT-mediated chloride transport in cells cultured in vitro. This drug also inhibits antigen presentation in T cells by inhibiting protein synthesis and cell division, as well as histone methylation during mitosis, leading to downregulation of cell-surface antigens on B cells.</p>Fórmula:C16H18N4OPureza:Min. 95%Cor e Forma:PowderPeso molecular:282.34 g/mola2b1Integrin Recognition Sequence
CAS:<p>a2b1Integrin Recognition Sequence is a chemotherapeutic drug that is used in experimental models of hyperproliferative diseases, such as cancer. It activates α subunit of integrins, which are expressed on cells and mediate the adhesion to extracellular matrix proteins. The drug binds to integrin receptors on the surface of tubule cells and promotes their death by apoptosis. This protein stabilizes hydrogen bonding interactions between two or more molecules that are present at a site of chemical reaction, thus inhibiting cellular proliferation and tumor growth. As a result, a2b1Integrin Recognition Sequence inhibits the proliferation of human serum albumin (HSA) and basic fibroblast growth factor (bFGF), which are cell culture models for α subunit-integrin receptor interactions. Analysis of the structure of this protein reveals an integrin recognition sequence motif with three invariant residues: Arg-Gly-Asp (RGD).</p>Fórmula:C14H22N4O9Pureza:Min. 95%Peso molecular:390.35 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C159H267N49O43Pureza:Min. 95%Peso molecular:3,553.13 g/molAvibactam descarbonyl
CAS:<p>Avibactam descarbonyl is a medicinal compound that has shown promise as an anticancer agent. It is an analog of kinase inhibitors, which are known to have potent anticancer activity. Avibactam descarbonyl has been shown to induce apoptosis in cancer cells and inhibit the growth of tumors in Chinese hamsters. This compound has also been found in urine samples from patients receiving avibactam therapy, suggesting that it may be a metabolite of this drug. Avibactam descarbonyl is a cyclin-dependent protein kinase inhibitor, which means that it can prevent the proliferation of cancer cells by blocking cell cycle progression. This compound has potential for use in cancer treatment due to its potent anticancer activity and ability to induce apoptosis in tumor cells.</p>Fórmula:C6H13N3O5SPureza:Min. 95%Peso molecular:239.25 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate
CAS:<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>Fórmula:C109H159N25O32S5•(C2H4O2)xPureza:Min. 95%Peso molecular:2,491.91 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H190N34O35Peso molecular:2,773.19 g/mol[Tyr1]-Adipokinetic Hormone, locust
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C58H78N14O15Peso molecular:1,211.5 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C198H312N62O58Peso molecular:4,488.96 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H110N24O14Peso molecular:1,403.71 g/molCathepsin S substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H66N12O9Peso molecular:871.08 g/molBone Matrix Proteins
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H67N13O14Peso molecular:954.06 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C176H285N47O49Peso molecular:3,843.47 g/mol[Tyr11]-Somatostatin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H102N18O20S2Peso molecular:1,651.91 g/molβ-Amyloid (1-33)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C164H242N46O51Peso molecular:3,673.94 g/mol[D-Phe11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H121N21O19Peso molecular:1,657 g/molH-9 hydrochloride
CAS:<p>H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.</p>Fórmula:C11H14ClN3O2SPureza:Min. 95%Cor e Forma:White To Off-White SolidPeso molecular:287.77 g/molLeucokinin IV
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H52N12O12Peso molecular:904.9 g/mol[D-Ser14]-Humanin (HN)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C119H204N34O32S2Peso molecular:2,687.28 g/molBAD (103-127), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C137H212N42O39SPeso molecular:3,103.54 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H66N10O18Peso molecular:1,023.07 g/mol[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C13H24N4O3Peso molecular:284.36 g/mol[Pyr4]-MBP (4-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C60H100N20O17Peso molecular:1,391.61 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H36N6O6Peso molecular:552.64 g/molMinigastrin I (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H99N15O26SPeso molecular:1,645.66 g/molp3K, (Lys 58 Lys 60 Lys 63) Ea(52-68)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H129N23O25Peso molecular:1,777.03 g/molIntermedin-53 (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C247H397N83O73S3Peso molecular:5,793.61 g/molcAMP Dependent PK Inhibitor (5-22), amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C84H137N29O26Peso molecular:1,969.16 g/molP69 (522-534), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H84N14O21Peso molecular:1,241.33 g/molIGF-II (33-40)
CAS:<p>This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.</p>Fórmula:C38H74N20O12Pureza:Min. 95%Peso molecular:1,003.12 g/mol[D-Ala2]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H35N5O7Peso molecular:553.6 g/molEndokinin A/B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H77N13O12SPeso molecular:1,084.32 g/molFmoc-D-Ser(BSi)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H31NO5SiPureza:Min. 95%Peso molecular:441.59 g/molGastric Inhibitory Polypeptide (1-30) (porcine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C162H244N40O48SPeso molecular:3,551.97 g/molAdipokinetic Hormone II Locusta Migratoria
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H57N11O11Peso molecular:904.02 g/molCJC-1295 trifluoroacetate
CAS:<p>A synthetic peptide that stimulates growth hormone release through GHRH receptors. TFA salt</p>Fórmula:C165H269N47O46Pureza:Min. 95%Cor e Forma:PowderPeso molecular:3,647.19 g/molMARCKS Substrate (151-175)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C147H246N41O40P3Peso molecular:3,320.78 g/molAcyl Carrier Protein (65-74) (amide)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H75N13O15Peso molecular:1,062.20 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C64H99N19O17Peso molecular:1,406.62 g/molHypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C180H287N57O48Peso molecular:4,017.55 g/molSALMF amide 1 (S1)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H60N10O10SPeso molecular:885.1 g/molSalmefamol
CAS:<p>A β2-adrenoceptor agonist that is structurally related to salbutamol. Ellicits β-adrenergic stimulatory effects on smooth muscles in trachea and bronchi. More effective (1.5 to 2 times more) as a bronchodilator than salbutamol.</p>Fórmula:C19H25NO4Pureza:Min. 95%Cor e Forma:SolidPeso molecular:331.41 g/mol[Met5, Lys6,7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C39H59N9O9SPeso molecular:830.02 g/molHepatitus B Virus Pre-S Region (120-145)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C135H199N39O38SPeso molecular:3,008.32 g/molHIV-gp120-41-N-B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C107H193N37O28Peso molecular:2,445.96 g/molMARCKS Protein (159-165)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H72N10O9Peso molecular:897.14 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Fórmula:C23H38N6O5·2HClPureza:Min. 95%Peso molecular:551.51 g/molβ III probe
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C87H143N27O28S3Peso molecular:2,111.45 g/mol
