
Glucagon Receptor
Glucagon receptors are GPCRs that mediate the effects of glucagon, a hormone involved in regulating glucose homeostasis by promoting glycogen breakdown and glucose release from the liver. These receptors are critical in the management of blood sugar levels and are of particular interest in the study of diabetes and metabolic disorders. Glucagon receptor antagonists are being explored as potential treatments for hyperglycemia in type 2 diabetes. At CymitQuimica, we offer a variety of high-quality glucagon receptor modulators to support your research in endocrinology, diabetes, and metabolic regulation.
Found 194 products of "Glucagon Receptor"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PF-06882961
CAS:PF-06882961 is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.Formula:C31H30FN5O4Purity:97.19% - 99.56%Color and Shape:SolidMolecular weight:555.6Glucagon (1-29), bovine, human, porcine hydrochloride
CAS:Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon increases HNF4α phosphorylation.Formula:C153H225N43O49S·ClHPurity:95.65% - 98.03%Color and Shape:SolidMolecular weight:3519.21Ref: TM-T15389L
1mg66.00€5mg173.00€10mg260.00€25mg449.00€50mg657.00€100mg887.00€200mg1,198.00€250mg1,368.00€Retatrutide
CAS:Retatrutide (LY3437943) is a triple agonist of GCGR, GIPR and GLP-1R that can be used to study obesity.Formula:C221H342N46O68Purity:98.31%Color and Shape:SolidMolecular weight:4732.09Crotedumab
CAS:Crotedumab (REGN1193) is a humanized antibody targeting GCGR, which reduces fasting blood glucose and improves glucose tolerance, used in diabetes research.Purity:>95%Color and Shape:LiquidMolecular weight:146.82 kDaTirzepatide monosodium salt
Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.Formula:C225H347N48O68NaPurity:99.69%Color and Shape:SoildMolecular weight:4835.51Retatrutide sodium salt
Retatrutide sodium salt is a glucagon receptor and glucagon-like peptide-1 receptor agonist for the study of type 2 diabetes mellitus.Purity:99.97%Color and Shape:SoildOrforglipron
CAS:Orforglipron (LY3502970; GLP-1 receptor agonist 1) is an orally available glucagon-like peptide (GLP-1) receptor agonist for the study of obesity and type 1Formula:C48H48F2N10O5Purity:99.47% - 99.8%Color and Shape:SolidMolecular weight:882.96Avexitide acetate
CAS:Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.Formula:C155H246N40O53SPurity:96.64% - 98.65%Color and Shape:SolidMolecular weight:3549.91Berobenatide
CAS:Berobenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist.Color and Shape:SolidGLP-1R Agonist DMB
CAS:GLP-1R Agonist DMB is an agonist of glucagon-like peptide 1 receptor (GLP-1R; KB = 26.3 nM for the recombinant human receptor).Formula:C13H15Cl2N3O2SPurity:99.52%Color and Shape:SolidMolecular weight:348.25[Gly8]-GLP-1(7-37) acetate
[Gly8]-GLP-1(7-37) acetate is a derivative of GLP-1, where glycine at position 8 is replaced with alanine. [Gly8]-GLP-1(7-37) acetate is also a peptide fragment of the GLP-1 receptor (GLP-1R) agonist, Dulaglutide.Color and Shape:Odour SolidGLP-1R Antagonist 1
CAS:GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).Formula:C16H11ClF6N4O2Purity:99.84%Color and Shape:SolidMolecular weight:440.73HAEGTFTSD
CAS:HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.Formula:C40H57N11O17Purity:98%Color and Shape:SolidMolecular weight:963.94Tirzepatide
CAS:Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.Formula:C225H348N48O68Purity:99.52% - 99.99%Color and Shape:SolidMolecular weight:4813.45HAEGT
CAS:HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.
Formula:C20H31N7O9Purity:98%Color and Shape:SolidMolecular weight:513.5Glucagon receptor antagonists-1
CAS:Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.Formula:C29H34FNO2Purity:98%Color and Shape:SolidMolecular weight:447.58V-0219 hydrochloride
V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.
Formula:C20H26ClF3N4O2Purity:99.97%Color and Shape:SoildMolecular weight:446.89GLP-1 moiety from Dulaglutide
GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.Formula:C149H221N37O49Purity:98%Color and Shape:SolidMolecular weight:3314.62HAEGTFTSD acetate(926018-45-3 free base)
HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted fromFormula:C42H61N11O19Purity:98%Color and Shape:SolidMolecular weight:1024.01GLP-1 receptor agonist 13
Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].Formula:C25H23ClF2N6OColor and Shape:SolidMolecular weight:496.94Albiglutide Fragment
CAS:Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).Formula:C148H224N40O45Purity:98%Color and Shape:SolidMolecular weight:3283.66α-Methylprednisolone 21-hemisuccinate sodium salt
CAS:6α-Methylprednisolone 21-hemisuccinate sodium salt (Asmacortone), a water-soluble ester, is used for allergic, cardiac, and hypoxic emergencies.Formula:C26H33NaO8Purity:99.65%Color and Shape:Lyophilized PowderMolecular weight:496.53Cinnamtannin A2
CAS:Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.
Formula:C60H50O24Color and Shape:SolidMolecular weight:1155.02Tirzepatide hydrochloride
Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.Formula:C225H349N48O68ClPurity:98%Color and Shape:SolidMolecular weight:4849.91Survodutide TFA
Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.Formula:C192H289N47O61·xC2HF3OC2Purity:99.29% - 99.96%Color and Shape:SolidMolecular weight:4231.62 (free base)Secretin (28-54), human TFA
Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.Formula:C132H221N44F3O42Purity:98%Color and Shape:SolidMolecular weight:3153.48VU0453379
CAS:VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).Formula:C26H34N4O2Purity:98%Color and Shape:SolidMolecular weight:434.57GLP-1 receptor agonist 4
CAS:GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.Formula:C51H44Cl2N4O6Purity:98%Color and Shape:SolidMolecular weight:879.82Glucagon (19-29), human
CAS:Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.Formula:C61H89N15O18SPurity:98%Color and Shape:SolidMolecular weight:1352.53Acmopatide
CAS:Acmopatide (Compound E-153) is a dual agonist of GIP and GLP-1 receptors and can be utilized in diabetes research.Color and Shape:SolidGlucagon Receptor Antagonist Inactive Control
CAS:Glucagon Receptor Antagonist Inactive Control is a Glucagon receptor antagonist that can be used in related research in the field of life sciences.Formula:C21H23BrN2OSColor and Shape:SolidMolecular weight:431.39TE-8105
TE-8105 is a GLP-1 receptor agonist that demonstrates prolonged and enhanced efficacy in models of diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Color and Shape:Odour SolidZovaglutide
CAS:Zovaglutide is a GLP-1 receptor agonist that is utilized in diabetes research.Color and Shape:SolidSecretin, canine TFA
Secretin, canine TFA, is an endocrine hormone that stimulates the secretion of pancreatic fluid rich in bicarbonate. Additionally, Secretin, canine TFA, can regulate the primary cell functions and paracellular permeability of gastric monolayer cells through an Src kinase-dependent pathway.Color and Shape:Odour SolidWB4-24
CAS:WB4-24 is a GLP-1 receptor agonist that enhances the release of β-endorphin in microglia. It exhibits antiallodynic, anti-inflammatory, and analgesic effects in mouse models of inflammation induced by formalin, carrageenan, and CFA.Formula:C52H48N4O14S2Color and Shape:SolidMolecular weight:1017.09GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3850.31GLP-1R agonist 34
CAS:GLP-1R agonist 34 (Compound 1) is an orally active small molecule agonist of the glucagon-like peptide-1 receptor (GLP-1R). It enhances insulin secretion, suppresses glucagon release, and slows gastric emptying, thereby effectively reducing blood glucose levels. GLP-1R agonist 34 holds potential for research into metabolic disorders such as type 2 diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Formula:C50H50F2N10O5Color and Shape:SolidMolecular weight:908.99GLP-1R agonist 20
GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.Formula:C31H30Cl2F2N4O5Molecular weight:646.15613SPN009
SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.Formula:C191H299N45O59Molecular weight:4167.17798VIP(6-28)(human, rat, porcine, bovine)
CAS:VIP(6-28) blocks VIP-induced cAMP signaling in humans, rats, pigs, and cows.Formula:C126H207N37O34SPurity:98%Color and Shape:SolidMolecular weight:2816.28Sorbinicate
CAS:Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.Formula:C42H32N6O12Purity:98%Color and Shape:SolidMolecular weight:812.74Semaglutide, FITC labeled
Semaglutide (FITC-labeled Semaglutide) is a long-acting analog of human glucagon-like peptide-1, functioning as an agonist of the GLP-1 receptor. It shows potential for research related to type 2 diabetes.Formula:C209H304N46O63SMolecular weight:4498.17191SDV-Exendin-3/4
SDV-Exendin-3/4 is a 32-amino acid peptide.Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3443.87GIP/GLP-1 dual receptor agonist-1 sodium
GIP/GLP-1 dual receptor agonist-1 (Compound 4) (sodium) functions as a GIP/GLP-1 receptor agonist. This compound is applicable for research into metabolic disorders and liver diseases, including non-alcoholic steatohepatitis (NASH) and non-alcoholic fatty liver disease (NAFLD).Color and Shape:Odour SolidPemvidutide TFA
Pemvidutide (TFA), a GLP-1R/GCGR dual agonist, effectively reduces body weight, liver fat, and serum lipid levels, and is utilized in research on non-alcoholicFormula:C182H275N39O54·xC2HF3O2Color and Shape:SolidMolecular weight:3873.35 (free base)Glucagon-like peptide 1 (1-37), human
CAS:Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.Formula:C186H275N51O59Purity:98%Color and Shape:SolidMolecular weight:4169.48Secretin (28-54), human
CAS:Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.Formula:C130H220N44O40Purity:98%Color and Shape:PowderMolecular weight:3039.46Albenatide
CAS:Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.
Formula:C26H47N7O9SPurity:98%Color and Shape:SolidMolecular weight:633.76HAEGTFTSDVS
CAS:HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.Formula:C48H71N13O20Purity:98%Color and Shape:SolidMolecular weight:1150.18Pal-Glu(OSu)-OH
CAS:Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.Formula:C25H42N2O7Color and Shape:SolidMolecular weight:482.618TT-OAD2
CAS:TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.
Formula:C50H49Cl4N3O6Purity:98%Color and Shape:SolidMolecular weight:929.75GLP-2(1-33)(human)
CAS:GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Formula:C165H254N44O55SPurity:98%Color and Shape:SolidMolecular weight:3766.19HAEGTFT
CAS:HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.Formula:C33H47N9O12Purity:98%Color and Shape:SolidMolecular weight:761.78GLP-1(7-36), amide acetate
CAS:GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.Formula:C151H230N40O47Purity:99.89%Color and Shape:SolidMolecular weight:3357.68Apraglutide
CAS:Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Formula:C172H263N43O52Purity:98%Color and Shape:SolidMolecular weight:3765.25Dulaglutide
CAS:Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).Color and Shape:SolidTaspoglutide
CAS:Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetesFormula:C152H232N40O45Purity:98%Color and Shape:SolidMolecular weight:3339.763LSN3160440
CAS:LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.Formula:C27H27Cl2N3OColor and Shape:SolidMolecular weight:480.43Secretin, porcine
CAS:Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.Formula:C130H220N44O41·xC2H4O2Purity:98%Color and Shape:SolidMolecular weight:N/ATT-OAD2 free base
CAS:TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.Formula:C50H47Cl2N3O6Purity:98%Color and Shape:SolidMolecular weight:856.83Des His1, Glu8 Exendin-4
Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.Formula:C179H277N47O59SPurity:99.92%Color and Shape:SolidMolecular weight:4063.46{Val1}-Exendin-3/4
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3241.7GLP-1R agonist 14
CAS:GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].Formula:C45H42F2N10O5Color and Shape:SolidMolecular weight:840.88GIP/GLP-1 dual receptor agonist-1
CAS:Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.Color and Shape:SolidMaridebart
CAS:Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].Color and Shape:LiquidGLP-1R agonist 29
GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.Color and Shape:Odour SolidExendin-3/4 (59-86)
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3055.49GLP-1(7-37)
CAS:GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.Formula:C151H228N40O47Purity:98%Color and Shape:SolidMolecular weight:3355.67HAEGTFTSDVS acetate
HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.Formula:C50H75N13O22Purity:97.47%Color and Shape:SolidMolecular weight:1210.2Bay 55-9837
CAS:Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.Formula:C167H270N52O46Purity:98%Color and Shape:SolidMolecular weight:3742.29Mazdutide acetate(2259884-03-0 free base)
Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.Purity:98.41%Color and Shape:Odour SolidVU0453379 hydrochloride
VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.03Semaglutide TFA
Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patientsFormula:C189H290F3N45O61Purity:99.69% - 99.94%Color and Shape:SolidMolecular weight:4225.6482Survodutide
CAS:Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.Formula:C192H289N47O61Purity:99.83%Color and Shape:SolidMolecular weight:4229.0957Albiglutide fragment TFA
Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as aFormula:C148H224N40O45·xC2HF3O2Color and Shape:Solid3-Deoxyglucosone
CAS:3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with proteinFormula:C6H10O5Purity:95%Color and Shape:SolidMolecular weight:162.14(R)-V-0219 hydrochloride
(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89Ribupatide
CAS:Ribupatide is a dual agonist of gastric inhibitory polypeptide (GIP) and glucagon-like peptide 1 (GLP-1) receptors and can be utilized in antidiabetic research.Color and Shape:SolidOxyntomodulin
CAS:GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.Formula:C192H295N59O60SPurity:98%Color and Shape:SolidMolecular weight:4421.86GLP-1 receptor agonist 8
CAS:GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.Formula:C34H36ClFN6O4Color and Shape:SolidMolecular weight:647.14[Des-His1,Glu9]-Glucagon amide
CAS:Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.Formula:C148H221N41O47SPurity:98%Color and Shape:SolidMolecular weight:3358.68GLP-1R agonist 27
GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).Formula:C32H33N5O4SeColor and Shape:SolidMolecular weight:630.6Vensemaglutide
CAS:Vensemaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in research related to diabetes or other metabolic disorders.Formula:C214H337N49O67Molecular weight:4668.25(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89GLP-1R agonist 15
CAS:GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .Formula:C46H47FN8O7SColor and Shape:SolidMolecular weight:874.98GLP-1R agonist 26
CAS:Compound 1, also known as GLP-1R agonist 26, is an agonist of the glucagon-like peptide-1 receptor (GLP-1R) with an EC50 of <10 nM.Formula:C32H29FN6O4SColor and Shape:SolidMolecular weight:612.67Liraglutide acetate
CAS:Liraglutide acetate is the acetate salt form of Liraglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in the study of type 2 diabetes.Formula:C172H265N43O51·xC2H4O2Color and Shape:SolidMolecular weight:3751.20 (free base)Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5PHI-27 (porcine)
CAS:PHI-27 (porcine) is a porcine-derived peptide consisting of 27 amino acids, utilized in the identification of peptide hormones and other bioactive peptides [1].Formula:C136H216N36O40Color and Shape:SolidMolecular weight:2995.39GLP-1R agonist 16
CAS:Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Formula:C50H58FN10O6PColor and Shape:SolidMolecular weight:945.03GLP-1R agonist 4
CAS:GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsColor and Shape:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3692.15Dapiglutide
CAS:Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Color and Shape:SolidGRPP (human)
CAS:GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Formula:C136H215N41O58SColor and Shape:SolidMolecular weight:3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formula:C56H86F3N15O11Color and Shape:SolidMolecular weight:1202.37GLP-1(9-36)amide TFA
GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.Formula:C142H215F3N36O45Color and Shape:SolidMolecular weight:3203.43DD202-114
CAS:DD202-114 is an effective and selective agonist of GLP1R. It promotes the accumulation of cAMP, reduces blood glucose levels, and decreases food intake. Additionally, DD202-114 holds potential for research in type 2 diabetes mellitus (T2DM) and obesity studies.Formula:C33H35FN4O5Color and Shape:SolidMolecular weight:586.65Utreglutide
CAS:Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formula:C191H298N46O58Color and Shape:SolidMolecular weight:4166.67Bay 55-9837 TFA
Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.Formula:C150H240F3ClN44O44Color and Shape:SolidMolecular weight:3456.22

