Glucagon Receptor
Glucagon receptors are GPCRs that mediate the effects of glucagon, a hormone involved in regulating glucose homeostasis by promoting glycogen breakdown and glucose release from the liver. These receptors are critical in the management of blood sugar levels and are of particular interest in the study of diabetes and metabolic disorders. Glucagon receptor antagonists are being explored as potential treatments for hyperglycemia in type 2 diabetes. At CymitQuimica, we offer a variety of high-quality glucagon receptor modulators to support your research in endocrinology, diabetes, and metabolic regulation.
Found 191 products of "Glucagon Receptor"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GLP-1R agonist 16
CAS:Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Formula:C50H58FN10O6PColor and Shape:SolidMolecular weight:945.03GLP-1R agonist 4
CAS:GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsColor and Shape:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3692.15Dapiglutide
CAS:Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Color and Shape:SolidGRPP (human)
CAS:GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Formula:C136H215N41O58SColor and Shape:SolidMolecular weight:3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formula:C56H86F3N15O11Color and Shape:SolidMolecular weight:1202.37GLP-1(9-36)amide TFA
GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.Formula:C142H215F3N36O45Color and Shape:SolidMolecular weight:3203.43Utreglutide
CAS:Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formula:C191H298N46O58Color and Shape:SolidMolecular weight:4166.67Bay 55-9837 TFA
Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.Formula:C150H240F3ClN44O44Color and Shape:SolidMolecular weight:3456.22Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.Formula:C165H252N44O48SColor and Shape:SolidMolecular weight:3652.1Tirzepatide TFA
Tirzepatide TFA, a GIP and GLP-1 agonist, targets type 2 diabetes treatment.Formula:C227H349F3N48O70Color and Shape:SolidMolecular weight:4927.47GLP-1R modulator C5
CAS:GLP-1R modulator C5 is a GLP-1R modulator that enhances GLP-1 binding to GLP-1R via transmembrane sites and can be used in the study of type II diabetes.Formula:C24H21NO3Purity:99.59%Color and Shape:SolidMolecular weight:371.43GLP-1R modulator C16
CAS:GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.Formula:C21H26ClFN2O3Purity:99.6% - >99.99%Color and Shape:SolidMolecular weight:408.89SCO-267
CAS:SCO-267 is a full agonist of GPR40/FFAR1， stimulating insulin secretion and GLP-1 release in diabetic rats, improving glucose tolerance,type 2 diabetes.Formula:C36H46N4O5Purity:99.89%Color and Shape:SolidMolecular weight:614.77GLP-1 receptor agonist 7
CAS:GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.Formula:C31H30ClFN4O5Color and Shape:SolidMolecular weight:593.05Anti-GCGR Antibody (7J909)
Anti-GCGR Antibody (7J909) is an antibody targeting GCGR. Anti-GCGR Antibody (7J909) can be used in ELISA.Color and Shape:Odour LiquidGlucagon (1-29), bovine, human, porcine
CAS:Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.Formula:C153H225N43O49SPurity:99.56% - 99.56%Color and Shape:SolidMolecular weight:3482.75GLP-1 receptor agonist 2
CAS:GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.Formula:C30H31ClFN5O4Color and Shape:SolidMolecular weight:580.05V-0219
CAS:V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.Formula:C20H25F3N4O2Purity:99.91%Color and Shape:SoildMolecular weight:410.43HAEGTFT acetate(926018-95-3 free base)
HAEGTFT acetate is the first N-terminal 1-7 residues of GLP-1 peptide.Formula:C35H51N9O14Purity:>99.99%Color and Shape:SolidMolecular weight:821.84PF-06291874
CAS:PF-06291874 (Glucagon receptor antagonists-4) (Glucagon receptor antagonists-4) is a highly effective and orally active antagonist of the glucagon receptor.Formula:C26H28F3N3O4Purity:99.12% - 99.27%Color and Shape:SolidMolecular weight:503.51GLP-1(7-37) acetate(106612-94-6 free base)
CAS:Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion.Formula:C151H228N40O47Purity:98.89%Color and Shape:SolidMolecular weight:3355.67Cotadutide acetate
Cotadutide acetate is a potent GLP-1 and glucagon receptor dual agonist with EC50s of 6.9 pM and 10.2 pM.Formula:C169H256N42O57Purity:98.28%Color and Shape:SolidMolecular weight:3788.14ML-SI3
CAS:CCG-143140 is a GLP-1 receptor inverse agonists.Formula:C23H31N3O3SPurity:99.75%Color and Shape:SolidMolecular weight:429.58Lixisenatide acetate (320367-13-3 free base)
CAS:Lixisenatide acetate is a receptor agonist similar to glucagon-like peptide-1 (glp-1) for the treatment of type 2 diabetes mellitus (T2DM).
Formula:C215H347N61O65S·6C2H4O2Purity:98% - 99.9%Color and Shape:SolidMolecular weight:5218.88BETP
CAS:BETP is an agonist of GLP-1 receptor (EC50s: 0.66 and 0.755 μM for human and rat GLP-1 receptor).Formula:C20H17F3N2O2SPurity:98.51%Color and Shape:SolidMolecular weight:406.42Liraglutide
CAS:Liraglutide (Liraglutida) is a synthetic analog of GLP-1, an agonist of the GLP-1 receptor. Liraglutide is an antidiabetic agent. Cost effective and quality assured.Formula:C172H265N43O51Purity:97.65% - 99.04%Color and Shape:SolidMolecular weight:3751.25Ref: TM-T6876
1mg111.00€2mg197.00€5mg447.00€10mg527.00€25mg843.00€50mg1,144.00€100mg1,521.00€200mg2,052.00€Exenatide
CAS:Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.Formula:C186H286N50O62SPurity:99.42%Color and Shape:SolidMolecular weight:4247Tirzepatide Acetate(2023788-19-2 free base)
Tirzepatide (LY3298176) Acetate (2023788-19-2 free base) is a new molecule that can control blood glucose levels.Cost-effective and quality-assured.Formula:C227H352N48O70Purity:97.3% - 98.05%Color and Shape:SolidMolecular weight:4873.5Exendin-4
CAS:Exenatide: GLP-1 receptor agonist, 39-amino acid, longer half-life (2.4 hrs), IC50 of 3.22 nM.Formula:C184H282N50O60SPurity:97.71% - 99.78%Color and Shape:SolidMolecular weight:4186.57GLP-1 receptor agonist 9
CAS:1H-Benzimidazole-6-carboxylic acid is a GLP-1 receptor agonist.Formula:C32H31ClFN3O5Purity:98%Color and Shape:SolidMolecular weight:592.06Semaglutide
CAS:Semaglutide is a glucagon-like peptide 1 receptor (GLP-1R) agonist(EC50 of 6.2 pM in a reporter assay using BHK cells expressing the human receptor).Formula:C187H291N45O59Purity:96.92% - 99.78%Color and Shape:SolidMolecular weight:4114Ref: TM-T19850
1mg126.00€5mg264.00€10mg378.00€25mg562.00€50mg780.00€100mg1,054.00€200mg1,419.00€500µg85.00€Glucagon-like peptide 1 (1-37), human acetate
Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist.Purity:98%Color and Shape:LiquidMolecular weight:N/ASecretin (33-59), rat
CAS:Secretin (33-59), rat (Secretin (rat)) is a classical hormone in the gastrointestinal system and a neuropeptide.Formula:C129H216N42O42Purity:98.12%Color and Shape:SolidMolecular weight:3027.35Albiglutide TFA (782500-75-8 free base)
Albiglutide TFA (782500-75-8 free base) (Albiglutide TFA) is a long acting GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus (T2DM).
Formula:C150H225F3N40O47Purity:>99.99%Color and Shape:SolidMolecular weight:3397.63GRA Ex-25
CAS:GRA Ex-25 (GRA-Ex-25) is an inhibitor of glucagon receptor.
Formula:C29H36F3N3O5Purity:98.2% - 98.88%Color and Shape:SolidMolecular weight:563.61Oxyntomodulin acetate
Oxyntomodulin acetate, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist[1].Purity:99.24%Color and Shape:LiquidMolecular weight:N/AExendin-4 acetate
CAS:Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).Formula:C186H286N50O62SPurity:98.48% - 99.93%Color and Shape:SolidMolecular weight:4247Glucagon (19-29), human acetate
Glucagon (19-29), human acetate a COOH-terminal fragment processed from glucagon, is a potent and efficient inhibitor of insulin secretion.Formula:C63H93N15O20SPurity:98.11%Color and Shape:SolidMolecular weight:1412.57Avexitide
CAS:Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.Formula:C149H234N40O47SPurity:98% - 99.65%Color and Shape:SolidMolecular weight:3369.76PF-06882961 Tris
CAS:PF-06882961 Tris (UNII-2HJV78O0SS) is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.Formula:C35H41FN6O7Purity:98.74% - 99.79%Color and Shape:SolidMolecular weight:676.7HAEGTFTSDVSSYLE
HAEGTFTSDVSSYLE is a peptide. GLP-I analog contains the sequence.
Formula:C71H103N17O28Purity:>99.99%Color and Shape:SolidMolecular weight:1642.71GLP-1(7-36), amide
CAS:GLP-1 secretion by human enteroendocrine NCI-H716 cells is augmented in a dose-dependent manner by the addition of CPE.Cost-effective and quality-assured.Formula:C149H226N40O45Purity:99.85%Color and Shape:White PowderMolecular weight:3297.63Shanzhiside methyl ester
CAS:Shanzhiside methylester soothes neuropathic pain by triggering spinal GLP-1 receptors, boosting microglial β-endorphin through p38 MAPK.Formula:C17H26O11Purity:98.998% - 99.32%Color and Shape:SolidMolecular weight:406.38Teduglutide acetate
Teduglutide acetate, a GLP-2 analogue, maximizes small intestinal mucosal hypertrophy.
Formula:C166H256N44O56SPurity:97.39%Color and Shape:SoildMolecular weight:3812.13Bay 55-9837 acetate
Bay 55-9837 acetate is a potent and highly selective VPAC2 agonist(Kd = 0.65 nM) and can be used in type 2 diabetes studies.Purity:98.27%Color and Shape:LiquidMolecular weight:N/ANNC-0640
CAS:NNC-0640 is a negative allosteric modulator of Human Glucagon Receptor with an IC50 of 69.2 nM.Formula:C29H31N7O4SPurity:97.04%Color and Shape:SolidMolecular weight:573.67Ref: TM-T7364
1mg48.00€2mg65.00€5mg96.00€10mg169.00€25mg298.00€50mg454.00€100mg655.00€1mL*10mM (DMSO)96.00€GLP-1 Receptor modulator 1
CAS:GLP-1 Receptormodulator 1 (Compound 7) is an effective positive allosteric modulator of the GLP-1 receptor. It is utilized in the research of obesity and type 2 diabetes.Formula:C18H21NOSMolecular weight:299.43GCGR antagonist 2
CAS:Orally active GCGR antagonist 2, a furan-2-carbohydrazide, binds hGluR at 2.3 nM. Blocks glucagon, inhibits rat receptor at 0.43 nM.Formula:C28H26N4O2Color and Shape:SolidMolecular weight:450.53Glucagon receptor antagonists-5
CAS:Oral indazole-based glucagon antagonist, Ki: 32 nM, may treat type 2 diabetes.Formula:C30H29ClF3N3O3Purity:98%Color and Shape:SolidMolecular weight:572.02Glucagon receptor antagonists-2
CAS:Glucagon receptor antagonist -2 is a highly effective glucagon receptor antagonist.Formula:C22H30FNO2Purity:98%Color and Shape:SolidMolecular weight:359.48BAY-27-9955
CAS:BAY-27-9955 is a glucagon receptor antagonist.Formula:C23H31FOColor and Shape:SolidMolecular weight:342.49(S)-V-0219
(S)-V-0219: oral, GLP-1R PAM, boosts calcium in hGLP-1R HEK cells, lowers glucose, curbs hunger in mice.Formula:C20H25F3N4O2Color and Shape:SolidMolecular weight:410.43MS012
CAS:MS012 is a Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase (Kd = 46 ± 15 nM).Formula:C22H35N5O2Color and Shape:SolidMolecular weight:401.55(R)-V-0219
(R)-V-0219: GLP-1R PAM, orally active, triggers Ca++ flux in HEK-hGLP-1R cells.Formula:C20H25F3N4O2Color and Shape:SolidMolecular weight:410.43GLP-1R agonist 1
CAS:GLP-1R agonist 1, an imidazole derivative and potent GLP-1R activator, may aid diabetes research.Formula:C32H29ClFN3O5Color and Shape:SolidMolecular weight:590.04PF-06412154 HCl
CAS:PF-06412154 HCl is a glucagon receptor antagonist.Formula:C24H28ClN3O3Color and Shape:SolidMolecular weight:441.96Efpeglenatide
CAS:Efpeglenatide is a long-acting GLP-1 receptor agonist that improves insulin sensitivity, lowers blood glucose, delays weight gain, and supports metabolic disease research.Purity:100% - 100%Color and Shape:SolidNNC 92-1687
CAS:NNC 92-1687 is a selective glucagon receptor antagonist that can be used to study type 2 diabetes.Formula:C15H12N2O3SPurity:98.70% - 99.96%Color and Shape:SolidMolecular weight:300.33L-168049
CAS:L-168049: Human glucagon receptor antagonist, IC50 - 3.7 nM human, 63 nM murine, 60 nM canine.Formula:C24H20BrClN2OPurity:>99.99%Color and Shape:SolidMolecular weight:467.79Ref: TM-T22893
1mg50.00€5mg105.00€10mg170.00€25mg358.00€50mg530.00€100mg758.00€500mg1,558.00€1mL*10mM (DMSO)116.00€GLP-1R agonist 3
CAS:GLP-1R agonist 3 is a GLP-1R agonist, an imidazole derivative.GLP-1R agonist 3 can be used to study diabetes and obesity.Formula:C31H28FN5O4Purity:97.19%Color and Shape:SolidMolecular weight:553.58Glucagon receptor antagonists-3
CAS:Glucagon receptor antagonist -3 is a highly effective glucagon receptor antagonist.Formula:C22H30FNO2Purity:98%Color and Shape:SolidMolecular weight:359.48GLP-1 receptor agonist 3
CAS:GLP-1 receptor agonist 3 is a GLP-1 receptor agonist,Example 4A-1, has EC50s of 1.1 nM and 13 nM in Clone H6 and Clone C6 cell lines assay, respectively.Formula:C31H30FN5O4Purity:98%Color and Shape:SolidMolecular weight:555.6MK 0893
CAS:MK 0893 is a potent and selective Glucagon Receptor (GR) antagonist competitive, reversible cAMP activity, which attenuates blood glucose elevation.Formula:C32H27Cl2N3O4Purity:98.79%Color and Shape:SolidMolecular weight:588.48GLP-1R agonist 17
CAS:GLP-1R agonist 17 excels in stimulating GLP-1 receptors, useful for cardiovascular metabolic disease research.Formula:C28H26ClFN4O4SColor and Shape:SolidMolecular weight:569.05LGD-6972 sodium
CAS:LGD-6972 sodium is a glucagon receptor antagonist.Formula:C43H46N2NaO5SPurity:98%Color and Shape:SolidMolecular weight:725.9GLP-1R agonist 9
CAS:GLP-1R agonist 9 acts as a GLP-1R agonist, demonstrating efficacy with EC50 values of 1.1 nM and 11 nM against CHO GLP-1R Clone H6 and Clone C6, respectively.Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05GLP-1R agonist 10
CAS:GLP-1R agonist 10 is a GLP-1 agonist (EC50: 0.051 nM).Formula:C29H29ClFN5O4Color and Shape:SolidMolecular weight:566.02MK3577
CAS:MK3577 is a glucagon receptor antagonist.Formula:C30H30ClFN2O3Color and Shape:SolidMolecular weight:521.02GLP-1R agonist 12
CAS:GLP-1R agonist 12 (Compound 123) 是一种 GLP-1R 激动剂，能够用于研究糖尿病。Formula:C34H36N6O4Color and Shape:SolidMolecular weight:592.69Antitumor agent-101
CAS:Antitumor agent-101 is a selective, covalent inhibitor targeting lysine methyltransferases G9a/GLP, demonstrating IC50 values of 8.5 nM for G9a and 5.5 nM forFormula:C26H38N6O3Purity:98%Color and Shape:SolidMolecular weight:482.62Lotiglipron
CAS:Lotiglipron (PF-07081532) is a GLP-1R agonist that lowers blood glucose and may be used in the study of type 2 diabetes mellitus (T2DM) and excess obesity.
Formula:C31H31ClN4O5Purity:98.3%Color and Shape:SolidMolecular weight:575.05Adomeglivant
CAS:Adomeglivant (LY2409021) is a potent and selective glucagon receptor antagonist. Which is used in clinical trial for type 2 diabetes mellitus.Formula:C32H36F3NO4Purity:99.91%Color and Shape:SolidMolecular weight:555.63LGD-6972
CAS:LGD-6972 is an antagonist of glucagon receptor.
Formula:C43H46N2O5SPurity:98.8% - 99.62%Color and Shape:SolidMolecular weight:702.9GLP-1 receptor agonist 16
CAS:GLP-1 receptoragonist 16 (Example 53) is a GLP-1 agonist applicable for research in diabetes, obesity, or diseases related to non-alcoholic steatohepatitis.Formula:C33H31ClFN3O4Color and Shape:SolidMolecular weight:588.068DA-302168S
CAS:DA-302168S is an orally active, selective GLP-1R agonist with an EC50 value of 1.32 nM. It promotes insulin secretion and has a hypoglycemic effect. Additionally, DA-302168S reduces food intake. It primarily activates GLP-1R in humans and monkeys, with minimal effect on GLP-1R in rats, mice, and dogs. DA-302168S can be used for research in type 2 diabetes and obesity.Formula:C33H24ClF2N3O5Color and Shape:SolidMolecular weight:616.011GLP-1 receptor agonist 12
CAS:Compound 20A, known as GLP-1 receptor agonist 12, acts as an agonist of the GLP receptor. It is utilized in researching diseases like diabetes [1].Formula:C31H31FN6O4Molecular weight:570.61GLP-1R agonist 32
CAS:GLP-1R agonist 32 (Compound 111) is an orally active and potent GLP-1R agonist with an EC50 value of 0.017 nM. It stimulates the production of cyclic adenosine monophosphate (cAMP) by activating GLP-1R, which enhances insulin secretion, suppresses glucagon release, and delays gastric emptying to regulate blood glucose levels. GLP-1R agonist 32 shows potential for research in type 2 diabetes, obesity, and related metabolic disorders.Formula:C32H31ClFN3O5Color and Shape:SolidMolecular weight:592.06GLP-1 receptor agonist 11
CAS:GLP-1 Receptor Agonist 11 (compound 3) acts as an effective agonist for the GLP Receptor, finding use in research related to conditions like diabetes and non-alc. fatty liver disease [1].Formula:C31H31ClFN3O4Color and Shape:SolidMolecular weight:564.05GLP-1 receptor agonist 15
CAS:GLP-1 receptor agonist 15 (Example 4) is a GLP receptor agonist with an EC50 of 0.74 nM. It exhibits an IC50 of 10.1 μM against the hERG potassium ion channel. This compound is applicable for research in the diabetes field.Formula:C32H31ClFN3O5Color and Shape:SolidMolecular weight:592.057GLP-1R agonist 33
CAS:GLP-1R agonist 33 (Compound 224) is a GLP-1 receptor agonist with potential applications in research related to diabetes, obesity, and non-alcoholic fatty liver disease (NAFLD).Formula:C30H27FN6O4Color and Shape:SolidMolecular weight:554.57PF-06372222
CAS:PF-06372222: a small-molecule that modulates GCGR and antagonizes GLP-1R, affecting insulin and glucagon.Formula:C26H28F3N5O3Purity:98%Color and Shape:SolidMolecular weight:515.53GLP-1R modulator-1
CAS:GLP-1R modulator-1 (Compound 384) is a potent and orally active selective agonist of the glucagon-like peptide-1 receptor (GLP-1R). It activates G protein-coupled signaling, leading to increased intracellular cAMP levels, enhanced insulin secretion, delayed gastric emptying, and reduced appetite. GLP-1R modulator-1 holds potential for research in type 2 diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Formula:C41H38ClFN6O4Color and Shape:SolidMolecular weight:733.23LXT34
CAS:LXT34 (Example 2) is a GPR120 agonist with anti-inflammatory properties. This compound enhances GLP-1 formation in the gastrointestinal tract and improves insulin resistance in macrophages and pancreatic cells. LXT34 is applicable in studies related to inflammatory conditions, such as type 2 diabetes, obesity, and non-alcoholic fatty liver disease.Formula:C18H21NO3SColor and Shape:SolidMolecular weight:331.43GLP-1 receptor agonist 10
CAS:GLP-1 Receptor Agonist 10 (Compound 42), an agonist of the GLP receptor, reduces glucose excursions and inhibits food intake in mice. It is useful for research into type 2 diabetes (T2DM) and obesity [1].Formula:C30H28F4N6O5Color and Shape:SolidMolecular weight:628.57SCH-900822
CAS:SCH-900822 is a potent and selective glucagon receptor antagonist.Formula:C34H43Cl2N7O2Color and Shape:SolidMolecular weight:652.66GLP-1R agonist 8
CAS:GLP-1R agonist 8 is a potent agonist of GLP-1R (EC50 < 2 nM).Formula:C33H32N4O5Color and Shape:SolidMolecular weight:564.63DS79932728
CAS:DS79932728 is an orally active inhibitor of G9a and GLP, with IC50 values of 12.6 nM and 75.7 nM, respectively. It induces the production of γ-globin, thereby increasing fetal hemoglobin (HbF) levels. In cynomolgus monkey models, DS79932728 enhances the proportion of F-reticulocytes (F-rets) and shows good oral absorption characteristics.Formula:C19H25N3OColor and Shape:SolidMolecular weight:311.421LSN3318839
CAS:LSN3318839 is a potent and orally available glucagon-like peptide-1 receptor (GLP-1R) modulator.LSN3318839 enhances GLP-1R G-protein-coupled signaling and can
Formula:C26H23Cl2N3O2Purity:99.21%Color and Shape:SolidMolecular weight:480.39Anti-GLP1R Antibody
Anti-GLP1R Antibody is a human antibody expressed in CHO cells, targeting GLP1R. For isotype controls, refer to Human IgG1 kappa, Isotype Control.
Color and Shape:Odour Liquid
