Glucagon Receptor
Glucagon receptors are GPCRs that mediate the effects of glucagon, a hormone involved in regulating glucose homeostasis by promoting glycogen breakdown and glucose release from the liver. These receptors are critical in the management of blood sugar levels and are of particular interest in the study of diabetes and metabolic disorders. Glucagon receptor antagonists are being explored as potential treatments for hyperglycemia in type 2 diabetes. At CymitQuimica, we offer a variety of high-quality glucagon receptor modulators to support your research in endocrinology, diabetes, and metabolic regulation.
Found 164 products of "Glucagon Receptor"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Color and Shape:Odour SolidExendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3055.49HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Formula:C20H31N7O9Purity:98%Color and Shape:SolidMolecular weight:513.5Bay 55-9837
CAS:<p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>Formula:C167H270N52O46Purity:98%Color and Shape:SolidMolecular weight:3742.29FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Color and Shape:SolidMolecular weight:3692.15Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Formula:C132H221N44F3O42Purity:98%Color and Shape:SolidMolecular weight:3153.48VU0453379
CAS:<p>VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).</p>Formula:C26H34N4O2Purity:98%Color and Shape:SolidMolecular weight:434.57VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.03GLP-1 receptor agonist 4
CAS:<p>GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.</p>Formula:C51H44Cl2N4O6Purity:98%Color and Shape:SolidMolecular weight:879.82Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Formula:C148H224N40O45·xC2HF3O2Color and Shape:SolidGlucagon (19-29), human
CAS:<p>Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.</p>Formula:C61H89N15O18SPurity:98%Color and Shape:SolidMolecular weight:1352.53(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89GLP-1 (9-36) amide
CAS:<p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>Formula:C140H214N36O43Purity:97%Color and Shape:SolidMolecular weight:3089.41Maridebart
CAS:<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Color and Shape:LiquidOxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Formula:C192H295N59O60SPurity:98%Color and Shape:SolidMolecular weight:4421.86GLP-1 receptor agonist 8
CAS:<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Formula:C34H36ClFN6O4Color and Shape:SolidMolecular weight:647.14[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Formula:C148H221N41O47SPurity:98%Color and Shape:SolidMolecular weight:3358.68GLP-1(7-37)
CAS:<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Formula:C151H228N40O47Purity:98%Color and Shape:SolidMolecular weight:3355.67GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Formula:C46H47FN8O7SColor and Shape:SolidMolecular weight:874.98
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
