Organic Halides

Cinnamoyl chloride is an organic compound that can be synthesized in an asymmetric fashion. It is a metabolite of cinnamoyl-CoA and has been shown to have photochemical properties. Cinnamoyl chloride has also been shown to inhibit the growth of cervical cancer cells. This compound also has hydroxyl groups, which may act as an amide or receptor activator. Cinnamoyl chloride may be used for the treatment of infectious diseases such as chlamydia and mycoplasma.

Please enquire for more information about Methyl 5-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.

Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.

GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt

Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

1-(4-Chlorothiophen-2-yl)ethanone is an oxychloride that belongs to the family of thiourea derivatives. It is synthesized by reacting phosphorus oxychloride with 2,3-dichloroacetophenone in a solvent such as dioxane or acetonitrile. The final product is purified by means of vacuum distillation and recrystallization from diethyl ether, hexane, and chlorinated hydrocarbons.

2-Methyl-6-(trifluoromethyl)aniline is a colorless, oily liquid with a sulfurous odor. It is soluble in water and alcohol. The reaction rate of 2-methyl-6-(trifluoromethyl)aniline with sulfoxides is faster than that of benzyl anilines, but slower than that of anilino derivatives. The addition of hydrophobic groups to the 2-methyl-6-(trifluoromethyl)aniline molecule increases the reaction rate. 2-Methyl-6-(trifluoromethyl)aniline can be used as an anesthetic agent because it is a potent inhibitor of nerve conduction in sciatic nerves. It also has been shown to be effective in desulfurizing propylene, which is important for the production of polypropylene plastics and synthetic rubber. 2-Methyl-6-(triflu

2-(3,4-Dichlorophenyl)ethanol is a high quality reagent for the synthesis of complex compounds, useful as an intermediate in organic synthesis and as a building block for speciality chemicals. This chemical is also used as a research chemical in the synthesis of versatile building blocks. It can be used as a reaction component in various reactions such as Suzuki coupling, Negishi coupling, Heck reaction, and Sonogashira coupling.

Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Ethyl 2-fluoroacetoacetate is a phosphorus oxychloride synthon that can be used to synthesize fluorinated compounds. It has been shown to react with a carbonyl group, like tyrosine, in the presence of an organocatalyst to form a tetrafluoroborate ester. The reaction mechanism of this compound is intramolecular hydrogen transfer from the phosphite oxygen atom to the electrophilic carbon atom. Ethyl 2-fluoroacetoacetate has been shown to react with alkyl halides and hydroxyl groups in the presence of base, forming enantiomeric alcohols. This compound has also been shown to have optical properties that are stable at room temperature and pressure, including infrared absorption maxima at 1740 cm-1 and 1775 cm-1 as well as ultraviolet absorption maxima at 225 nm and 254 nm.

Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

2,3-Dichloroanisole is a volatile organic compound that has been shown to be an attractant for termites. It is used as a pesticide and agrochemical. 2,3-Dichloroanisole is used as an insecticide against termites and other pests in agriculture. This chemical has been shown to inhibit the sodium channel of the nerve cell membrane, which leads to paralysis of insects. The mechanism of action for this compound is not well understood but it has been suggested that it may act by blocking the reorientation of the sodium ion channels. 2,3-Dichloroanisole can also be used as a metal salt in some thermodynamic reactions.

Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page