Biochemicals and Reagents

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

(S)-Luliconazole is an antifungal agent that is synthesized from an imidazole compound. This compound is biphenyl in structure and is often derived through chiral synthesis techniques to isolate the (S)-enantiomer, which is the active form that enhances pharmacological effects. Its mode of action involves inhibiting the enzyme lanosterol 14α-demethylase, an essential component in fungal cell membrane synthesis. This inhibition disrupts the production of ergosterol, a critical sterol in fungal membranes, ultimately leading to increased membrane permeability and cell death.

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Panaxynol is an active compound that belongs to the group of polyphenols. It has been shown to inhibit nuclear DNA synthesis in human leukemic HL-60 cells. This inhibition is due to its ability to bind with the dextran sulfate moiety of DNA, thereby preventing DNA synthesis. Panaxynol also has antibacterial efficacy against gram-positive bacteria and significant cytotoxic effects on HL-60 cells.

Catalogue peptide; min. 95% purity

Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

AZD 5991 is a cell-specific compound that inhibits the apoptosis pathway. It has been shown to have potent antitumor activity against T-cell lymphomas and other cancers in vitro and in vivo. AZD 5991 targets cyclin D2 and PCSK9, which are proteins involved in the regulation of the cell cycle, thereby inhibiting tumor growth. This drug also exhibits potent inhibition of ribosome synthesis, which may be due to its ability to inhibit protein synthesis by targeting the enzyme activities required for ribosome production. AZD 5991 also exhibits anti-inflammatory properties that may be due to its ability to inhibit colony-stimulating factor (CSF) production.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Fluorescent derivative of cyclopamine

Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

ALX-1393 is a synthetic compound that acts as an inhibitor, specifically targeting the glycine transporter 1 (GlyT1). As a small molecule inhibitor derived from chemical synthesis, it modulates neurotransmitter systems by blocking the reuptake of glycine, an important co-agonist of the NMDA receptor, in the central nervous system. The mode of action of ALX-1393 involves binding to the GlyT1 transporter, thereby increasing the synaptic concentration of glycine. This elevation in glycine levels enhances NMDA receptor function, which is crucial for synaptic plasticity, learning, and memory.

Please enquire for more information about 1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Steroid Free Serum is a high-quality serum that is free from steroids. It is commonly used in various Life Sciences applications, including research and diagnostic assays. This serum contains important components such as alpha-fetoprotein, angiotensin-converting enzyme, collagen, erythropoietin, pegylated growth factor, chemokines, and antibodies with neutralizing properties.

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.

FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).

8-(3-Chlorostyryl)caffeine is a caffeine derivative that binds to the adenosine A3 receptor. It has been shown to inhibit locomotor activity and increase diastolic pressure in knockout mice lacking the adenosine A3 receptor. 8-(3-Chlorostyryl)caffeine has also been shown to have inhibitory properties on cyclase, which is necessary for the production of cAMP, the second messenger in cells. This drug also inhibits dopamine release from neurons and hydrogen bond formation with DNA, protein, and other biomolecules. Lastly, 8-(3-Chlorostyryl)caffeine can bind to both A1 and A2A receptors as well as to dna binding sites.

Siratiazem is a calcium-channel blocker that is used for the treatment of cardiac arrhythmia and hypertension, as well as for the prevention of congestive heart failure. Siratiazem is a prodrug that is converted to its active form by hydrolysis in the liver. It binds to the L-type calcium channels in cardiac muscle cells, thereby blocking calcium influx and decreasing the excitability of these cells. This drug has been shown to be effective in phase 1 clinical trials, with no major adverse effects. Siratiazem can cause symptoms such as nausea, vomiting, diarrhea, or constipation and may also have effects on insulin resistance and ventricular dysfunction.

Please enquire for more information about Oligopeptide-51 including the price, delivery time and more detailed product information at the technical inquiry form on this page

The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes

1,2-Dipalmitoyl-3-dimethylammonium-propane is a cationic lipid, which is a type of synthetic lipid commonly used in biochemical and biophysical research. It is sourced from chemical synthesis, involving the formulation of lipid molecules with specific chemical modifications to confer particular properties. The mode of action of this compound involves its ability to integrate into lipid bilayers and form liposomes. These liposomes can encapsulate nucleic acids, facilitating their delivery into cells by merging with cell membranes, which is crucial for gene delivery applications.

Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page

Fentanyl p Conjugate for use in immunoassays

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.

S 25585 is a psychostimulant that has been shown to modulate the function of animals. It can be used in the treatment of cancer and autoimmune diseases, as well as to induce overfeeding in animals. S 25585 is an endogenous molecule with a cyclic structure. The affinity for binding of S 25585 to its receptor may depend on whether it is bound or unbound at the time of binding. This drug also has anti-cancer effects, which are due to its ability to inhibit uptake and stabilize cells that are not undergoing cell division. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside (Rifapentine) is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing

a brain-penetrating activator of eukaryotic initiation factor 2B (eIF2B) that inhibits the abnormal integrated stress response

L-MobileTrex is an advanced analytical technology platform, which is a product of cutting-edge research in data science and computational modeling. This platform operates by integrating multi-dimensional datasets through sophisticated algorithms, providing enhanced data visualization and interpretability.

Please enquire for more information about MS67N including the price, delivery time and more detailed product information at the technical inquiry form on this page

Pigment Red 48 (C.I. 15865) is a red organic pigment that is soluble in water and most organic solvents. It has a melting point of 200°C and is used in paints, plastics, textiles, paper, and other products. Pigment Red 48 (C.I. 15865) can be synthesized by the diazonium salt coupling reaction between an aromatic amine and an acid chloride. The pigment also has a hydroxyl group that enables it to form covalent bonds with other molecules such as polymers or proteins. Pigment Red 48 (C.I. 15865) is used in many products because of its high stability, excellent heat resistance, low toxicity, non-irritating properties, high transparency, and good color fastness to light and washing.BR> Pigment Red 48 (C.I. 15865) is not considered hazardous according to the Globally Harmonized System of Classification and Lab

L 162389 is a synthetic, non-steroidal, anti-inflammatory drug (NSAID) that inhibits the enzyme cyclooxygenase. It inhibits the production of prostaglandins, which are known to cause pain and inflammation in the body. L 162389 is used for the treatment of inflammatory conditions such as rheumatoid arthritis and osteoarthritis.

CB-1158 is an arginase inhibitor, which is a small molecule derived from a synthetic source designed to modulate immune functions. Its mode of action involves the inhibition of the arginase enzyme, a key player in the urea cycle responsible for the hydrolysis of arginine into ornithine and urea. By blocking arginase, CB-1158 effectively prevents the depletion of extracellular arginine, a vital amino acid required for the activation and proliferation of T cells within the immune system. This inhibition leads to enhanced immune responses against tumors.

Parainfluenza viruses (PIVs) belong to the Paramyxoviridae family and are a common cause of respiratory infections, particularly in children.
There are four main types: Human Parainfluenza virus-1 (HPIV-1), HPIV-2, HPIV-3, and HPIV-4, each associated with different patterns of illness. HPIV-1 and HPIV-2 are the primary causes of colds and croup. HPIV-3 often leads to bronchitis and pneumonia, while it is thought HPIV-4 causes similar symptoms HPIV-3.
Parainfluenza viruses spread through respiratory droplets and while most infections are mild, infants, young children, and immunocompromised individuals may experience severe respiratory illness.
Parainfluenza Virus Type 2 Antigen has potential application in the development of diagnostic assays to detect antibodies in patient samples, confirming HPIV-2 infection. It can also be used as a research tool in vaccine development.