Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,661 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(362 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
N-(2-Azidoethyl)betulonamide
CAS:Please enquire for more information about N-(2-Azidoethyl)betulonamide including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C32H50N4O2Purity:Min. 95%Molecular weight:522.8 g/molS-Ruxolitinib (INCB018424)
CAS:Ruxolitinib is a janus tyrosine kinase inhibitor active specifically on sub-types JAK1 and JAK2 with IC50 values in the nanomolar range. JAK1 and JAK2 are kinases involved in the regulation of hematopoiesis. Clinically applied to the treatment of intermediate and high-risk myelofibrosis, ruxolitinib is usually well tolerated by patients.Formula:C17H18N6Purity:Min. 95%Molecular weight:306.37 g/molMomelotinib mesylate
CAS:Momelotinib mesylate is a potent, selective inhibitor of PD-L1. It has been shown to inhibit the expression of PD-L1 in vitro and in vivo. Momelotinib mesylate binds to the B7-H1 protein found on cells that line blood vessels, which is a protein target for tumor cells. It also inhibits the proliferation of cancer cells and may lead to their death. Momelotinib mesylate has been approved by the FDA as a treatment method for patients with myelofibrosis who have had no success with other treatments. This drug is given orally and can be used together with other medications such as steroids or erythropoietin. It has been shown to reduce organ damage and improve quality of life in these patients.Formula:C24H26N6O5SPurity:Min. 95%Molecular weight:510.6 g/molNotch 4 homolog antibody
Notch 4 homolog antibody was raised in rabbit using a synthetic peptide representing an internal region of the human NOTCH homolog 4 (NOTCH4) protein as the immunogen.Purity:Min. 95%ELN-441958
CAS:ELN-441958 is a linker that is immunocompetent and potently competitive with the linker molecule. The ELN-441958 binds to the antigen on the CD4 receptor, which is found on the surface of immunocompetent cells, and this binding causes an autoimmune response in mice. ELN-441958 has been shown to be effective against a number of autoimmune diseases, such as rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. It also has anti-inflammatory properties in mice with induced colitis. The polymer is biocompatible and can be used for a number of purposes as a linker molecule in drug development, including pain models and other types of models for inflammatory diseases. ELN-441958 is also virulent in immunodeficient mice but not immunocompetent mice.Formula:C29H29ClN4O2Purity:Min. 95%Molecular weight:501.02 g/molBimolane
CAS:Bimolane is an immunosuppressive agent, which is a synthetic chemotherapeutic drug with a distinctive mode of action involving the interference with DNA synthesis and inhibition of lymphocyte proliferation. The compound achieves this by intercalating into DNA strands, thereby disrupting the replication process and ultimately exerting its cytotoxic effects on rapidly dividing cells, such as those in the immune system. This mechanism of action positions Bimolane as a potent agent for suppressing immune responses.Formula:C20H32N6O6Purity:Min. 95%Molecular weight:452.5 g/molYWHAZ antibody
YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGENGFAP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Additionally, it has been shown to have a high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Purity:Min. 95%Cytokeratin 8+18 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin 8+18 antibody (Prediluted for IHC)
Purity:Min. 95%Matrix Metalloproteinase-13, human, recombinant
Matrix Metalloproteinase-13 is a metalloproteinase with a broad substrate specificity. It is used as a prognostic factor for cancer patients, and is also used to diagnose and monitor inflammatory bowel disease. In addition, it has been shown to have chemiluminescence activity in the presence of hydrogen peroxide. The MMP-13 protein can be detected using Western blotting with monoclonal antibodies against the human MMP-13 protein. This recombinant human Matrix Metalloproteinase-13 (rMMP-13) can be used as an antigen for immunoassays such as ELISA and RIA.Purity:Min. 95%D-myo-Inositol 1-[(2R)-2,3-bis[(1-oxooctyl)oxy]propyl hydrogen phosphate] ammonium
CAS:D-myo-Inositol 1-[(2R)-2,3-bis[(1-oxooctyl)oxy]propyl hydrogen phosphate] ammonium is a peptide that can be used as an activator of ion channels and as a research tool for the study of protein interactions. It is also used to inhibit protein synthesis in cells.Formula:C25H50NO13PPurity:Min. 95%Molecular weight:603.64 g/molTheiler's Murine Encephalomyelitis virus protein
Purified native Theiler's Murine Encephalomyelitis virus proteinPurity:Min. 95%Lactoferrin protein (Apo)
Purified native Human Lactoferrin proteinPurity:≥ 95% As Determined By Sds-Page.N-(1-Deoxy-D-fructos-1-yl)-L-threonine
CAS:Please enquire for more information about N-(1-Deoxy-D-fructos-1-yl)-L-threonine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H19NO8Purity:Min. 95%Molecular weight:281.26 g/molCofilin 1 antibody
Cofilin 1 antibody was raised in mouse using recombinant human Cofilin 1 (1-166aa) purified from E. coli as the immunogen.CD18 antibody (PE)
CD18 antibody (PE) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.Purity:Min. 95%Andrographiside
CAS:Andrographiside is a sesquiterpene lactone that is extracted from the plant Andrographis paniculata. It has been shown to have chemiluminescence activity and inhibition of drug transporter activity in vitro. This compound is not well-studied, but has been shown to have biological properties such as hepatoprotective effects in rats.Formula:C26H40O10Purity:Min. 95%Molecular weight:512.59 g/molHistone H2B antibody
The Histone H2B antibody is a valuable tool in Life Sciences research. This polyclonal antibody specifically targets Histone H2B, a protein involved in DNA packaging and gene regulation. It has high affinity for Histone H2B and shows minimal cross-reactivity with other proteins.Bedoradrine-d6
CAS:Bedoradrine-d6 is an analog of bedoradrine that acts as a potent inhibitor of kinases. It has been shown to inhibit the activity of cyclin-dependent kinases, which play a critical role in the regulation of cell division and proliferation. Bedoradrine-d6 has demonstrated promising anticancer effects in cancer cells, inducing apoptosis and inhibiting tumor growth. This protein kinase inhibitor has been extensively studied in Chinese hamster ovary cells and human cancer cell lines, showing significant medicinal potential for cancer treatment. As a kinase inhibitor, bedoradrine-d6 represents a promising therapeutic option for cancer patients who require targeted therapy to combat their disease.Formula:C24H32N2O5Purity:Min. 95%Molecular weight:428.5 g/molBI-3812
CAS:BI-3812 is a selective metal-ion sensor that can be used to detect the presence of metal ions in a sample. The BI-3812 has an operable design and is positioned axially, which increases its sensitivity to ion detection. It also has high photometric accuracy and can be used with a plate or orbital photometer. The BI-3812 uses spectroscopic analysis to measure the element present in the sample, which is then converted into an optical density value using photometry. This process is interactive and can be done in real time.Formula:C26H32ClN7O5Purity:Min. 95%Molecular weight:558.03 g/molTIP39 (Human, Bovine)
TIP39 is a peptide inhibitor that is a member of the TIP family. It inhibits the activity of calcineurin, a calcium-dependent phosphatase enzyme, and thereby prevents it from dephosphorylating nuclear factor of activated T cells cytoplasmic 1 (NFATc1), which regulates signaling pathways that control inflammatory responses. TIP39 has been shown to inhibit calcineurin in both human and bovine cell lines. This drug has been used as a research tool to study peptide-receptor interactions and ion channels.
Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.2 g/molSmad3 antibody
The Smad3 antibody is a polyclonal antibody that specifically targets the growth hormone receptor. It is commonly used in life sciences research to study the activation of various signaling pathways. This antibody has been shown to neutralize the effects of progesterone, dopamine, and chemokines by binding to their respective receptors. The Smad3 antibody can be used in various experimental techniques such as immunohistochemistry, Western blotting, and ELISA. It is produced using high-quality excipients and undergoes rigorous quality control measures to ensure its efficacy and specificity. With its ability to detect and inhibit specific proteins, the Smad3 antibody is an invaluable tool for researchers in the field of molecular biology.CNQX disodium salt
CAS:CNQX disodium salt is a drug that inhibits the release of glutamate, an excitatory neurotransmitter. It has been shown to reduce locomotor activity in animals and to inhibit axonal growth in vitro. In vivo, CNQX disodium salt has been shown to inhibit both protein synthesis and neurotransmission in the cerebellum. The chronic exposure of CNQX disodium salt has been shown to induce symptoms similar to those seen in Alzheimer's disease patients, although this effect is reversible after withdrawal of the drug. CNQX disodium salt can also be used as an experimental model for studying how chronic exposure affects brain function. A study using rats demonstrated that CNQX disodium salt can decrease gamma-aminobutyric acid (GABA) levels by inhibiting calcium binding.Formula:C9H2N4Na2O4Purity:Min. 95%Molecular weight:276.12 g/molYM 244769
CAS:YM 244769 is a novel compound that is a selective inhibitor of the cytosolic calcium-ATPase (SERCA) pump. The SERCA pump plays an important role in maintaining the intracellular calcium concentration and removing Ca2+ from the cytosol to the extracellular space, which is required for nerve transmission. YM 244769 blocks this pump and inhibits Ca2+ reuptake by the endoplasmic reticulum, which leads to increased levels of cytosolic Ca2+. This compound has been shown to reduce chronic pain in animal models induced by nerve injury.Formula:C26H24Cl2FN3O3Purity:Min. 95%Molecular weight:516.4 g/molDMBX1 antibody
DMBX1 antibody was raised in rabbit using the middle region of DMBX1 as the immunogen
Purity:Min. 95%CD69 antibody (PE-CY7)
CD69 antibody (PE-CY7) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.Purity:Min. 95%GPR160 antibody
GPR160 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%PLAT antibody
PLAT antibody is a test compound used to detect the presence of autoantibodies in samples. These autoantibodies are antibodies that target and attack the body's own tissues or cells. The PLAT antibody can be used in various assays and experiments to study the role of these autoantibodies in different diseases and conditions.
UF010
CAS:UF010 is a potential cancer therapy that has been shown to induce dedifferentiation of cancer cells. It also has been shown to protect against ischemic reperfusion injury in animal studies. UF010 inhibits acetylation, histone methylation, and DNA methylation in cancer cells. These changes are thought to be associated with the induction of apoptosis by inhibition of the myeloid-derived suppressor cell. In addition, UF010 inhibits HDACs and DNA methyltransferases, which may be responsible for its potent anticancer activity.Formula:C11H15BrN2OPurity:Min. 95%Molecular weight:271.15 g/molAkt antibody (Ser124)
Akt, or Protein Kinase B (PKB), is a kinase crucial for cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to external signals like growth factors. Activated through phosphorylation at specific sites, Akt influences key cellular processes by promoting cell survival, aiding protein synthesis through mTOR activation, regulating glucose metabolism, and supporting blood vessel formation and cell movement. Its hyperactivation is common in cancers, making it a target for cancer therapies, while its role in glucose regulation links it to insulin resistance and type 2 diabetes.BT-11
CAS:BT-11 is a synthetase that is expressed in the human intestine. It has been shown to have a role in allergic symptoms and clinical pathology, as well as enzyme activities such as those of the inflammatory cytokine TNF-α. BT-11 has also shown insect resistance in a model system and can be used for the production of pharmaceuticals. BT-11 has been shown to cause neuronal death when administered to humans, suggesting it may play a role in bowel disease.
As an enzyme, BT-11 is involved with polymerase chain reaction (PCR) and DNA template synthesis. BT-11 is toxic to humans at high doses, but has not been found toxic at low doses.Formula:C30H24N8O2Purity:Min. 95%Molecular weight:528.56 g/molCD25 antibody (Spectral Red)
CD25 antibody (Spectral Red) was raised in rat using alpha chain IL-2 receptor as the immunogen.Purity:Min. 95%CD25 antibody (Allophycocyanin)
CD25 antibody (Allophycocyanin) was raised in rat using alpha chain IL-2 receptor as the immunogen.Purity:Min. 95%ON-013100
CAS:ON-013100 is a protease inhibitor that inhibits the activity of the chymotrypsin-like proteases and trypsin family. It has been shown to inhibit cancer cell growth and induce apoptosis. ON-013100 also has immunomodulatory effects, which have been demonstrated by an increase in tumor necrosis factor receptor 1 (TNFR1) expression, as well as an increase in the release of proinflammatory cytokines such as interleukin 6 (IL-6) and tumor necrosis factor alpha (TNFα).
Formula:C19H22O7SPurity:Min. 95%Molecular weight:394.44 g/molCD19 antibody (PE-CY7)
CD19 antibody (PE-CY5.5) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.Purity:Min. 95%BIN3 antibody
The BIN3 antibody is a highly specialized monoclonal antibody that targets specific growth factors and proteins in the body. It has been extensively studied for its ability to neutralize the effects of hepatocyte growth factor, collagen, and other proteins involved in cell growth and development. This antibody has also shown promising results in inhibiting multidrug resistance in cancer cells by targeting cytochrome enzymes involved in drug metabolism. Additionally, the BIN3 antibody has been found to interact with fibronectin and low-density lipoprotein receptors, suggesting potential therapeutic applications in cardiovascular diseases. With its unique properties and specificity, this monoclonal antibody holds great promise for future research and development in various fields of medicine.GR 125743
CAS:GR 125743 is a small molecule compound that acts as a selective antagonist of the chemokine receptor CCR5. It is derived from a synthetic source designed to inhibit the interaction between the CCR5 receptor and its natural ligands. The primary mode of action involves blocking the CCR5 receptor, which is a critical co-receptor used by the Human Immunodeficiency Virus (HIV) to enter and infect host cells. By preventing this interaction, GR 125743 hinders the virus's ability to propagate within the host organism.Formula:C25H28N4O2Purity:Min. 95%Molecular weight:416.5 g/molNIM811
CAS:NIM811 is an antimicrobial agent that inhibits the growth of a wide range of bacteria by binding to the bacterial ribosome. NIM811 has been shown to be active against resistant mutants and neuronal death in vitro. NIM811 was also shown to protect against mitochondrial membrane potential collapse and to maintain intracellular ATP levels in vivo human cells. The mechanism of action for NIM811 may be due to its ability to inhibit Toll-like receptor signaling, which can lead to the activation of the immune system. This drug has been shown to have synergistic effects when used in combination therapy with other drugs, such as active antiretroviral therapy.Formula:C62H111N11O12Purity:Min. 95%Molecular weight:1,202.6 g/mol1-(2-Ethylphenyl)-5-[[5-(4-fluorophenyl)-2-furanyl]methylene]-2,4,6(1H,3H,5H)-pyrimidinetrione
CAS:1-(2-Ethylphenyl)-5-[[5-(4-fluorophenyl)-2-furanyl]methylene]-2,4,6(1H,3H,5H)-pyrimidinetrione is a protein inhibitor that binds to and inhibits the activation of the receptor for the peptide hormone calcitonin gene-related peptide (CGRP). It is a competitive inhibitor of CGRP with a Ki value of 0.7 nM. 1-(2-Ethylphenyl)-5-[[5-(4-fluorophenyl)-2-furanyl]methylene]-2,4,6(1H,3H,5H)-pyrimidinetrione is also an antibody and has been shown to be effective in preventing neuronal death in animal models of Alzheimer's disease.Formula:C23H17FN2O4Purity:Min. 95%Molecular weight:404.4 g/molCSF2 antibody
CSF2 antibody was raised in Mouse using a purified recombinant fragment of human CSF2(aa18-144) expressed in E. coli as the immunogen.KPT 9274
CAS:KPT 9274 is a molecule that binds to the citric acid cycle effector protein, β-catenin. It has minimal toxicity and is energy-independent. KPT 9274 blocks ATP production by binding to the death protein and inhibits atp production. KPT 9274 has been shown to be effective against high-risk disease such as acute myeloid leukemia (AML). The pharmacokinetic properties of KPT 9274 have been studied in vivo using a rat model. This drug is metabolized by fatty acid oxidation and glucuronidation in the liver and excreted in bile.
Formula:C35H29F3N4O3Purity:Min. 95%Molecular weight:610.63 g/molFXN antibody
The FXN antibody is a growth factor that belongs to the family of epidermal growth factor-like proteins. It is a cytotoxic conjugate used in Life Sciences research, specifically in the field of Monoclonal Antibodies. This antibody targets specific proteins, such as basic protein, and has cytotoxic properties that can inhibit cell growth and division. The FXN antibody can be used in various applications, including the development of inhibitors for specific proteins or as a tool to study autoantibodies. It is also commonly used in combination with other antibodies, such as anti-CD33 antibody, to enhance its effectiveness. With its high specificity and potency, the FXN antibody is a valuable tool for researchers in the field of Life Sciences.Gliorosein
CAS:Controlled ProductGliorosein is a mixture of naturally occurring orsellinic acids that has been shown to have anticancer activity. The compounds are biosynthesized by Streptomyces sp., which is an aerobic bacterium. These orsellinic acids have been shown to inhibit the growth of cancer cells by interfering with the synthesis of DNA and RNA, as well as inhibiting protein synthesis. Gliorosein may be effective against other types of cancer cells, such as leukemia and lymphoma, due to its ability to inhibit nucleic acid synthesis.
Formula:C10H14O4Purity:Min. 95%Molecular weight:198.22 g/molNGAL antibody
The NGAL antibody is a monoclonal antibody that targets the glycoprotein NGAL (Neutrophil Gelatinase-Associated Lipocalin). NGAL is involved in various biological processes, including collagen metabolism, glutamate homeostasis, and regulation of TGF-beta signaling. The NGAL antibody specifically recognizes sugar moieties present on the surface of NGAL and can be used for various applications in Life Sciences.Mannose-Binding Lectin 2, human, recombinant
Mannose-binding lectin 2 (MBL2) is a protein that is encoded by the MBL2 gene. It is an activator of the lectin complement pathway, which plays an important role in innate immunity. MBL2 binds to mannose-rich oligosaccharides and activates the lectin complement pathway. This protein also interacts with ion channels, cell surface receptors and other proteins. The recombinant human MBL2 has been expressed in E. coli. The purified protein is supplied at >95% purity and has a CAS number of 80613-62-8.
Purity:Min. 95%Oxendolone
CAS:Oxendolone is a synthetic, non-steroidal hormone that stimulates the release of growth hormone (GH) from the anterior pituitary gland. It is used in the treatment of GH deficiency and Turner syndrome. Oxendolone also has been found to act as an activator of ion channels, as well as binding to other receptors such as dopaminergic, serotoninergic and benzodiazepine receptors. This drug binds to protein ligands by binding to the amino acid residues near the active site of enzymes or receptors. It also can be used as a research tool for pharmacology and cell biology studies in order to study protein interactions and peptides.BR>
Formula:C20H30O2Purity:Min. 95%Molecular weight:302.5 g/molBovine Transferrin antibody
Affinity purified Sheep polyclonal Bovine Transferrin antibodyPurity:Min. 95%(R)-Zanubrutinib
CAS:Inhibitor of Bruton's tyrosine kinase (BTK)Formula:C27H29N5O3Purity:Min. 95%Molecular weight:471.55 g/molCD3 antibody (biotin)
CD3 antibody (biotin) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.4-(4-Amino-2,6-dimethylphenyl)morpholin-3-one
CAS:4-(4-Amino-2,6-dimethylphenyl)morpholin-3-one (4ADMPMO) is a research tool designed to study protein interactions. 4ADMPMO is an inhibitor that binds to the ligand binding site of ion channels, peptides, and receptors. 4ADMPMO also has been shown to activate certain ion channels such as potassium channels and calcium channels. This drug can inhibit the activity of voltage gated sodium channels.Formula:C12H16N2O2Purity:Min. 95%Molecular weight:220.27 g/molUNC2170 trifluoroacetate
CAS:UNC2170 trifluoroacetate is a small-molecule inhibitor, which is developed through targeted synthesis at academic and research institutions. This compound is specifically designed to interact with bromodomains, which are motifs within proteins involved in recognizing and interpreting acetylated lysines on histone tails, crucial for epigenetic regulation.Formula:C14H21BrN2O·C2HF3O2Purity:Min. 95%Molecular weight:427.26 g/molTaprenepag isopropyl
CAS:Taprenepag isopropyl is a model system that has been used in the clinical development of new drugs. The drug was tested in vitro and in vivo, with synergistic combinations, to treat glaucoma patients. Taprenepag isopropyl was found to be safe and effective in treating glaucoma patients and it did not cause any adverse effects. Studies have shown that Taprenepag isopropyl can be an effective treatment for glaucoma patients when combined with other treatments.Formula:C27H28N4O5SPurity:Min. 95%Molecular weight:520.6 g/mol2-Ethylphenol-d10
CAS:2-Ethylphenol-d10 is a growth factor that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research and experimentation purposes. This compound has been found to enhance the biomass production in certain organisms, leading to increased productivity. Additionally, 2-Ethylphenol-d10 is involved in the synthesis of important molecules such as tocopherol (vitamin E) and fatty acids.
Formula:C8H10OPurity:Min. 95%Molecular weight:132.23 g/molMetahexamide
CAS:3-Amino-4-Methylbenzenesulfonylcyclohexylurea (3AMBC) is a drug that is used to treat metabolic disorders, autoimmune diseases, and other conditions. 3AMBC inhibits the production of free fatty acids by binding to the enzyme acyl-CoA synthetase 2 (ACS2). The bound form of 3AMBC has been shown to have a higher affinity for ACP2 than the free form, which may account for its strong inhibition of fatty acid synthesis. 3AMBC also has anti-inflammatory properties and has been shown to inhibit the production of inflammatory cytokines in mice with collagen-induced arthritis. This drug also binds to neutrophils and macrophages, which may account for its anti-inflammatory effects. 3AMBC is an antidiabetic agent that increases glucose uptake in liver cells and improves glucose tolerance in diabetic patients. It also inhibits the release of glucose from the liver into the bloodstream byFormula:C14H21N3O3SPurity:Min. 95%Molecular weight:311.4 g/molDHX16 antibody
DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVPurity:Min. 95%Cct239065-d7
CAS:Cct239065-d7 is a peptide that is a potent activator of the human orphan G protein-coupled receptor, GPRC6A. It has been shown to inhibit the activity of ion channels and ligand-gated ion channels, leading to reduced excitability in neuronal cells. Cct239065-d7 has also been shown to be an inhibitor of Kv3.4 potassium channels and other voltage-gated potassium channels. This peptide binds to the extracellular domain of these potassium channels and inhibits their function by binding to the site where ATP would bind, leading to decreased neuronal excitability. Cct239065-d7 is a high purity compound with a purity level > 98%. The chemical name for this product is 3-[2-(1H-benzo[d]imidazol-2-yl)ethyl]-5-(4-(piperidin-1-yl)phenyl)-Formula:C29H29N7O3SPurity:Min. 95%Molecular weight:555.7 g/molPTCBI (cis- and trans- mixture)
CAS:PTCBI is a research tool used in cell biology, pharmacology and biochemistry. It is an inhibitor of ion channels that are activated by ligands. PTCBI has been shown to be a high-quality product that is made from the cis- and trans- mixture of 3,4-dichloro-N-[2-(1H-tetrazol-5-yl)phenyl]benzamide (CAS No. 79534-91-1).
Formula:C36H16N4O2Purity:Min. 95%Molecular weight:536.55 g/mol(+)-Muscarine chloride
CAS:Controlled ProductMuscarinic acetylcholine receptor agonistFormula:C9H20NO2•ClPurity:Min. 95%Color and Shape:PowderMolecular weight:209.71 g/molACTB MS Calibrator (25nmol)
High quality, quantitated heavy/light peptide calibrator for actin beta in Mass Spectroscopy research. Actin beta is an actin isoform and is one of two non-muscle cytoskeletal actins. Actins play roles in cell integrity, structure and motility.Purity:Min. 95%CD69 antibody (Spectral Red)
CD69 antibody (Spectral Red) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.Purity:Min. 95%ADAM2 antibody
ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVILPurity:Min. 95%OUL 35
CAS:Oul35 is a human protein that has been shown to have a role in the pathogenic mechanism of several inflammatory diseases, including cancer. Oul35 is an integral component of the mitochondrial respiratory chain and has been shown to be involved in oxidative phosphorylation. Oul35 is also localized in the nucleus and has been shown to regulate transcription of genes related to inflammation and cell proliferation. It has also been implicated in the regulation of nuclear factor kappa-light-chain-enhancer (NF-κB) activation. The molecular modeling studies on oul35 have shown that this protein binds adenosine diphosphate ribose (ADPR) through its N terminus. Oul35 plays an important role in cancer therapy as it can be used as a target for drug development. Oul35 can be assayed using ADP-ribose, which is produced by cells during energy production. This molecule can be detected by immunoassays or HPLC analysis after incubFormula:C14H12N2O3Purity:Min. 95%Molecular weight:256.26 g/molRTS-V5
CAS:RTS-V5 is a protein inhibitor that inhibits the activity of plasminogen activator inhibitor-1 (PAI-1), a protein that prevents fibrinolysis. RTS-V5 binds to PAI-1 and blocks its ability to inhibit the activity of plasminogen activators, which are enzymes that break down blood clots. This inhibition leads to increased levels of the active form of plasminogen activators, which in turn increases the rate of fibrinolysis. RTS-V5 has been shown to be effective against cancer cells in vitro and in animal models by inhibiting growth factor receptors. The mechanism of action for anticancer activity is not fully understood, but it may be due to inhibition of amp-activated protein kinase and/or ubiquitin proteasome system.Formula:C27H35N5O6Purity:Min. 95%Molecular weight:525.6 g/molLETM1 antibody
LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNGRK2 antibody
The GRK2 antibody is a monoclonal antibody that targets the G protein-coupled receptor kinase 2 (GRK2). This antibody has shown efficacy in neutralizing the effects of GRK2, which plays a crucial role in various cellular processes. It has been found to inhibit the activation of growth factors and mesenchymal stem cells, making it a potential therapeutic option for conditions related to abnormal cell growth. Additionally, the GRK2 antibody has been studied for its potential anticoagulant properties, as it can bind to fatty acids and antiphospholipid antibodies, reducing their plasma levels. This specific antibody shows promise in the field of Life Sciences and may have applications in treating conditions such as insulin resistance and complications associated with oral contraceptives.UKI-1
CAS:UKI-1 is a mutant form of the enzyme urokinase, which is used for the treatment of cancer. It has shown to inhibit metastasis by binding to the extracellular matrix and preventing cells from migrating. UKI-1 has also been found to have a structure that resembles benzamidine, a ligand that can be used as a template for optimisation. The crystal structure of UKI-1 has revealed that it contains an active site with amino acid residues that are similar to those of plasminogen activator (PA) molecules, which are molecules that are involved in blood clotting.Formula:C32H47N5O5SPurity:Min. 95%Molecular weight:613.32979Fluorofenidone
CAS:Fluorofenidone is an antifibrotic compound, which is a synthetic molecule. It functions by inhibiting the synthesis of collagen and other extracellular matrix components, mitigating the progression of fibrotic diseases. This mode of action involves the modulation of signaling pathways crucial to fibroblast proliferation and differentiation, ultimately reducing tissue fibrosis.Formula:C12H10FNOPurity:Min. 95%Molecular weight:203.21 g/molPI-1840
CAS:PI-1840 is a small molecule that can inhibit the proteasome and thus induce cancer cell apoptosis. PI-1840 has been shown to be an inhibitor of the immunoproteasome, which is an enzyme involved in protein degradation. PI-1840 also sensitizes cancer cells to bortezomib, a drug that inhibits the proteasome. PI-1840 has been shown to be effective against human cancer cells in culture and has potential as an anticancer agent.Formula:C22H26N4O3Purity:Min. 95%Molecular weight:394.47 g/molCD45.2 antibody (CY5)
CD45.2 antibody (CY5) was raised in mouse using CD45.2 as the immunogen.Purity:Min. 95%EPM2A antibody
EPM2A antibody was raised in mouse using recombinant human EPM2A (243-331aa) purified from E. coli as the immunogen.06:0-12:0 NBD pa
CAS:NBD-PE is a fluorescent probe for the detection of calcium ion channels, and it can be used to study the activity of ion channels in living cells. NBD-PE is a ligand that binds to an activator site on the receptor protein. It is used as a research tool in cell biology, biochemistry, and pharmacology. When NBD-PE is bound to an activator site on the receptor protein, it will activate or inhibit ion channels by changing their permeability to calcium ions.Formula:C27H46N5O11PPurity:Min. 95%Molecular weight:647.65 g/molDL-valine-3-d1
CAS:Please enquire for more information about DL-valine-3-d1 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C5H11NO2Purity:Min. 95%Molecular weight:118.15 g/molC13ORF8 antibody
C13ORF8 antibody was raised in rabbit using the middle region of C13ORF8 as the immunogenPurity:Min. 95%M8-B hydrochloride
CAS:M8-B hydrochloride is a monoclonal antibody that binds to the extracellular domain of the cation channel (TRPA1) and inhibits its activity. It has been shown to inhibit spontaneous pain in mice with neuropathic pain and inflammatory pain. M8-B hydrochloride also blocks TRPA1 activity in prostate cancer cells, which are used as an experimental model for prostate cancer.Formula:C22H24N2O3S·HClPurity:Min. 95%Molecular weight:432.96 g/mol11-Methyloleoside
CAS:11-Methyloleoside is a ligustraloid glycoside that has potent antibacterial activity. It is extracted from the fruit of the ligustrum lucidum plant, which contains potent antibacterial agents such as ligustrosidic acid and hydrochloric acid. 11-Methyloleoside can be detected by a chromatographic method with high sensitivity in the range of parts per billion. The compound has been shown to inhibit insulin sensitivity and reduce hepatic steatosis in mice fed a high fat diet. 11-Methyloleoside also exhibits conformational properties that are characteristic of monoterpenoid indole alkaloids.Formula:C17H24O11Purity:Min. 95%Molecular weight:404.4 g/molHHV6 gp60 + gp100 antibody
HHV6 gp60/gp100 antibody was raised in mouse using 60/110 KDa envelope glycoprotein of HHV6 as the immunogen.Cdx1 antibody
Cdx1 antibody was raised in rabbit using the C terminal of Cdx1 as the immunogenPurity:Min. 95%CTNNB1 antibody
The CTNNB1 antibody is a monoclonal antibody that is used in immunochemical staining assays. It specifically targets the CTNNB1 protein, which plays a crucial role in pluripotent stem cell maintenance and differentiation. This antibody has a high molecular weight cut-off, allowing it to effectively detect and bind to the CTNNB1 protein in various biological samples. The CTNNB1 antibody can be used in a variety of applications, including Western blotting, immunohistochemistry, immunofluorescence, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it an ideal tool for researchers studying the function and expression of the CTNNB1 protein in different biological contexts. With its reliable performance and accurate results, the CTNNB1 antibody is an essential component for any laboratory conducting studies on pluripotent stem cells or related research areas.MOV10L1 antibody
MOV10L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLAZD 5363
CAS:AZD 5363, also called Capivasertib, inhibits AKT1, AKT2, AKT3, P70S6K and PKA. A pyrrolopyrimidine derivative with antineoplastic activity.Formula:C21H25ClN6O2Purity:Min. 95%Molecular weight:428.92 g/molNSC 23766
CAS:Inhibitor of RAC GTP-ases
Formula:C24H35N7·3HClPurity:Min. 95%Molecular weight:530.96 g/molCYP4V2 antibody
CYP4V2 antibody was raised using the middle region of CYP4V2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTIPurity:Min. 95%DHX15 antibody
DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFButein tetramethyl ether
CAS:Butein tetramethyl ether is a peptide that can be used as a research tool for Cell Biology, Ligand, Pharmacology and Life Science. It is an inhibitor of ion channels and Receptor and activator of Ion channels. Butein tetramethyl ether has the CAS number 155048-06-9.Formula:C19H20O5Purity:Min. 95%Molecular weight:328.4 g/molFLJ14803 antibody
FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK
Purity:Min. 95%
![D-myo-Inositol 1-[(2R)-2,3-bis[(1-oxooctyl)oxy]propyl hydrogen phosphate] ammonium](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FKQD79576.webp&w=3840&q=75)
![1-(2-Ethylphenyl)-5-[[5-(4-fluorophenyl)-2-furanyl]methylene]-2,4,6(1H,3H,5H)-pyrimidinetrione](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FXNA39783.webp&w=3840&q=75)
