Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LGALS3BP antibody
The LGALS3BP antibody is a monoclonal antibody that targets LGALS3BP, a phosphatase involved in various biological processes. This antibody can be used for research purposes in the field of life sciences. LGALS3BP is known to interact with several molecules, including interferon and interleukin-6, and it plays a role in glycation, neutralizing fatty acids, collagen synthesis, and growth factor signaling. The LGALS3BP antibody can be used to study the endocytic uptake of LGALS3BP and its interaction with galectin-3-binding proteins. With its high specificity and affinity, this antibody is a valuable tool for researchers studying the functions of LGALS3BP in different cellular processes.Huntingtin antibody
The Huntingtin antibody is a specific antibody that targets the huntingtin protein, which is associated with Huntington's disease. This monoclonal antibody is produced by a hybridoma cell line and has been extensively studied in various research fields, including Life Sciences. It has been shown to bind to the huntingtin protein and inhibit its function, making it a promising tool for studying the role of this protein in disease progression.SB 216763
CAS:GSK3 serine/threonine protein kinase inhibitor; neuroprotective;cardioprotectiveFormula:C19H12Cl2N2O2Purity:Min. 95%Molecular weight:371.22 g/molALOX12 antibody
ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFVaccinia virus antibody
Vaccinia virus antibody was raised in rabbit using new york city board of health (NYCBOH) strain, Vaccinia (whole virus) as the immunogen.Purity:Min. 95%Podoplanin antibody
Podoplanin antibody was raised using the middle region of PDPN corresponding to a region with amino acids VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMPurity:Min. 95%SDC4 antibody
The SDC4 antibody is a highly effective immunoassay tool that allows for the accurate quantitation of various target molecules. This monoclonal antibody specifically binds to SDC4, a cell surface receptor protein involved in various cellular processes. The SDC4 antibody can be used in conjunction with streptavidin to create an electrode-based detection system, enabling the precise measurement of target molecules in samples.MUC12 antibody
MUC12 antibody was raised in rabbit using residues 541-555 [WEDQNLRESRFGLEN] of the human MUC12 protein as the immunogen.Purity:Min. 95%ACOT11 antibody
ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE
Purity:Min. 95%J51
CAS:J51 is a mutant strain of p. aeruginosa that has been modified to express green fluorescent protein (GFP) under the control of the lacZ promoter. This strain can be used as a model system for studying gene expression and regulation in bacteria, specifically how cells respond to changes in their environment. The J51 strain has been shown to produce GFP when exposed to light at wavelengths of 490 nm or greater, which is one characteristic that distinguishes it from the wild type strain. The J51 strain also produces more GFP than the wild-type strain when exposed to iron-deficient conditions.Formula:(C72H93F2N3S6)nPurity:Min. 95%LDH antibody
LDH antibody was raised in goat using full length lactate dehydrogenase protein isolated from rabbit muscle as the immunogen.Purity:Min. 95%Trans-capsaicin-d3
CAS:Trans-capsaicin-d3 is an analog of capsaicin, a compound found in chili peppers. It has been shown to have potent anticancer properties and acts as an inhibitor of protein kinases involved in cancer cell proliferation. In Chinese hamster ovary cells, Trans-capsaicin-d3 has been shown to induce apoptosis (cell death) in cancer cells. This compound has also been detected in human urine after ingestion of capsaicin, indicating that it may have potential as a therapeutic agent for the treatment of cancer.Formula:C18H27NO3Purity:Min. 95%Molecular weight:305.4 g/molLYVE1 antibody
LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.Purity:Min. 95%CYP4B1 antibody
CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW
Purity:Min. 95%Rk 20448-trihydrochloride-d3
CAS:Rk 20448-trihydrochloride-d3 is a chemical compound that can be used in the development of new drugs. It has been shown to have antimicrobial activity against a number of bacterial species, including methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. Rk 20448-trihydrochloride-d3 is soluble in water and organic solvents, which makes it suitable for use as an active ingredient in drug formulations. Rk 20448-trihydrochloride-d3 has also been shown to enhance the effect of antibiotics when used together with these drugs.Formula:C29H34N6OPurity:Min. 95%Molecular weight:482.6 g/molC20ORF100 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C20ORF100 antibody, catalog no. 70R-7817HIV1 Nef protein
The HIV1 Nef protein is a vital component in the field of Life Sciences. It is a serine protease inhibitor that plays a crucial role in neutralizing the effects of HIV1. This Recombinant Protein & Antigen forms dimers and has been extensively studied for its potential therapeutic applications. Researchers have found that it exhibits inhibitory effects on the replication of HIV1, making it a promising target for drug development.Purity:>95% By Sds-PageGPBAR-A
CAS:GPBAR-A is an active form of Glucose-dependent insulinotropic polypeptide (GIP) that has been shown to increase insulin sensitivity. GPBAR-A is a peptide hormone that belongs to the glucagon family and has been found to activate physiological responses in the pancreas, liver, and intestines. It is produced by pancreatic beta cells in response to glucose and increases insulin secretion from the pancreas. GPBAR-A also reduces hepatic steatosis in mice fed a high fat diet, which may be due to its ability to stimulate fatty acid oxidation by activating peroxisome proliferator-activated receptors (PPARs).Formula:C23H15F7N2O2Purity:Min. 95%Molecular weight:484.37 g/molBM 957
CAS:BM 957 is a potent and selective protein inhibitor that binds to the ATP-binding site of the enzyme, FKBP12. It inhibits the activity of FKBP12 in the cell and mitochondria by preventing it from binding to its natural substrate, FK506. BM 957 has been shown to inhibit the growth of cancer cells and induce apoptosis. This drug also inhibits cell proliferation by inhibiting protein synthesis. The high values observed in pharmacokinetic studies may be due to its ability to cross the blood-brain barrier. BM 957 is highly potent against chemoresistant tumor cells, which is likely due to its ability to inhibit cell growth, inducing apoptotic cell death.
Formula:C52H56ClF3N6O7S3Purity:Min. 95%Molecular weight:1,065.7 g/mol7-Hydroxy ondansetron
CAS:7-Hydroxy ondansetron is an active form of ondansetron that is selectively extracted from human serum using a liquid-liquid extraction procedure. It has been shown to have the same activity as the racemic mixture of 7-hydroxy and (S)-7-hydroxy ondansetron in inhibiting the uptake of diazepam, and it can be used as a marker for human serum. The uptake rate of 7-hydroxy ondansetron was found to be statistically dependent on the concentration of caffeine in solution and can be measured by high performance liquid chromatography analysis. The chromatographic method used to measure this uptake rate is based on the use of acetonitrile as a mobile phase, which is applied to a C18 column with a gradient elution program.Formula:C18H19N3O2Purity:Min. 95%Molecular weight:309.4 g/molERAL1 antibody
ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMCP-135807
CAS:CP-135807 is a potent and selective serotonin reuptake inhibitor that is structurally related to benzodiazepines. CP-135807 has been shown to be a 5-HT1A receptor agonist with high affinity in animals. CP-135807 also has serotonergic properties and can inhibit the uptake of serotonin at synapses. CP-135807 has been shown to have potent antidepressant effects in animal models, as well as anxiolytic effects due to its interactions with benzodiazepine receptors.Formula:C19H21N5O2Purity:Min. 95%Molecular weight:351.4 g/molPDEF antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.GLP-2 (Human)-EIA Kit (1ea)
GLP-2 is a gut peptide that belongs to the glucagon-like peptide family. It is produced by K cells in the ileum and colon, and also by L cells in the stomach. GLP-2 is composed of 31 amino acids, has a molecular weight of 3,000 daltons, and has an amino acid sequence that is highly conserved among species. The EIA kit for human GLP-2 (GLP-2 Human) is designed to detect the presence of GLP-2 in samples from human serum or plasma.Purity:Min. 95%BAY-876
CAS:BAY-876 is a small-molecule inhibitor, which is a synthesized compound with a specific mode of action targeting the glucose transporter 1 (GLUT1). GLUT1 is primarily responsible for glucose uptake across the plasma membranes of mammalian cells, a critical process for cellular metabolism and energy production. BAY-876 inhibits GLUT1 by binding to its active site, thus preventing glucose transport into cells. This inhibition disrupts the metabolic processes within cancer cells, as they heavily rely on glucose for growth and proliferation due to the Warburg effect.Formula:C24H23NO3Purity:Min. 95%Molecular weight:373.4 g/molPILRA antibody
PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNPurity:Min. 95%IL3 beta antibody
IL3 beta antibody was raised in goat using highly pure recombinant rat IL-3beta as the immunogen.Purity:Min. 95%Glutapyrone
CAS:Glutapyrone is a polymeric matrix that is composed of glutamic acid, polyethylene glycol, and polyvinyl alcohol. It is used to treat acute liver failure by reducing the amount of free fatty acids in the blood. Glutapyrone prevents the formation of conjugates with fatty acids and also has antioxidative activity. In rat kidneys, glutapyrone reduces the level of ubiquitin-proteasome system and increases mitochondrial membrane potential. This drug also has respiratory control effects, which may be due to its ability to increase mitochondrial membrane potential and reduce respiratory chain inhibition caused by lipopolysaccharide.Formula:C19H24N2Na2O9Purity:Min. 95%Molecular weight:470.4 g/molAZD4320
CAS:AZD4320 is a molecule that binds to the CDK4/CDK6 complex, which controls the cell cycle. AZD4320 has been shown to induce apoptosis in cancer cells by triggering mitochondrial membrane depolarization and long-term treatment of chronic lymphocytic leukemia. AZD4320 also inhibits the proliferation of leukemic cells by binding to CDK4/CDK6. This agent has potential as an anti-leukemic drug because it can be used in combination with monoclonal antibodies and thrombocytopenia drugs.Formula:C45H48ClF3N4O7S3Purity:Min. 95%Molecular weight:945.5 g/molCytokeratin 10+13 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin 10+13 antibody (Prediluted for IHC)Purity:Min. 95%(R,R)-Sertraline
CAS:Controlled Product(R,R)-Sertraline is an enantiomer of the antidepressant drug Sertraline. It is a reactive compound that can form conjugates with nucleophiles and has been shown to be antiviral in vitro. (R,R)-Sertraline binds to the 5-hydroxytryptamine (5-HT) receptor sites, which are located on neurons and musculoskeletal cells. The virus has been shown to be able to bind to these receptors as well, which may lead to a decreased ability of the body's immune system to fight off viral infections. The thermodynamic properties of this drug have also been studied, showing that it has a higher affinity for the (S) form than the (R) form. This means that the drug will tend to convert from one enantiomeric form into another in vivo when given as a racemic mixture.Formula:C17H17Cl2NPurity:Min. 95%Molecular weight:306.2 g/molCD80 antibody
The CD80 antibody is a monoclonal antibody that targets the CD80 protein, which plays a crucial role in immune responses. It has been shown to inhibit the interaction between CD80 and its receptors, including CTLA-4 and PD-L1, leading to enhanced T-cell activation and proliferation. This antibody has been used in various studies to investigate the role of CD80 in different biological processes, such as dopamine signaling, growth factor regulation, endothelial cell growth, and cell adhesion through E-cadherin. Additionally, it has been found to modulate actin dynamics and chemokine production. The CD80 antibody has also been studied for its potential therapeutic applications in diseases like cancer and autoimmune disorders. Its unique properties make it a valuable tool for researchers in the field of Life Sciences.
rac-Cubebin
CAS:Cubebin is a racemic mixture of two enantiomers, (-)-Cubebin and (+)-Cubebin. It is a potent activator of TRPV1 receptors and has been shown to inhibit the activity of the protein kinase C (PKC) in cells. Cubebin also binds to the beta-subunit of voltage-gated potassium channels, inhibiting its function as an inhibitor. Cubebin has been used as a research tool for studying protein interactions and as a pharmacological probe for understanding ion channel modulation.Formula:C20H20O6Purity:Min. 95%Molecular weight:356.4 g/molComplement C2 antibody
Complement C2 antibody was raised in goat using highly purified human complement protein as the immunogen.Purity:Min. 95%C6 antibody
The C6 antibody is a highly activated protein that acts as an inhibitor of tumor necrosis factor-alpha (TNF-α). It is widely used in Life Sciences research for its ability to target and neutralize TNF-α, a key player in inflammation and immune response. The C6 antibody has shown promising results in various studies, including its ability to inhibit the binding of TNF-α to its receptors and reduce the production of inflammatory mediators.SMAD2 antibody
The SMAD2 antibody is a highly effective tool in the field of Life Sciences. It is an antibody that specifically targets SMAD2, a protein involved in various cellular processes. This antibody has been extensively studied and has shown to have potent protease activity, making it an ideal choice for researchers working on protease-related projects.SPHK1 antibody
SPHK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%DHX30 antibody
DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKDHydrochlorothiazide-13C,d2
CAS:Hydrochlorothiazide-13C,d2 is a research tool that is used to study the interactions between ligands and receptors. It is a 13C,d2 labeled form of hydrochlorothiazide, which has been shown to be an activator of ion channels. Hydrochlorothiazide-13C,d2 was developed using high-purity technology and is available in quantities ranging from 1 mg to 10 g. This product can be used in the study of protein interactions, pharmacology, peptides, and other life science applications.
Formula:C7H8ClN3O4S2Purity:Min. 95%Molecular weight:300.7 g/molPD 173074
CAS:Inhibitor of FGFR1 receptor tyrosine kinaseFormula:C28H41N7O3Purity:Min. 95%Molecular weight:523.67 g/mol18:1-6:0 Biotin pi(4,5)P2
CAS:Biotin is a coenzyme that plays an important role in the metabolism of fat and protein. Biotin is required for the synthesis of fatty acids and for the production of acetyl-coenzyme A from pyruvate. It also participates in gluconeogenesis, the conversion of pyruvate to glucose, and in cholesterol synthesis. Biotin deficiency may lead to skin rash, hair loss, impaired growth, or nerve degeneration. Biotin is a ligand for certain receptors such as the retinoic acid receptor and thyroid hormone receptor. In addition to its role as a ligand, biotin has been shown to act as an activator for some ion channels such as calcium channels.Formula:C43H87N6O21P3SPurity:Min. 95%Molecular weight:1,149.16 g/molZNF547 antibody
ZNF547 antibody was raised in rabbit using the N terminal of ZNF547 as the immunogenPurity:Min. 95%TNKS antibody
TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids VSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKESU5408
CAS:SU5408 is a small molecule that inhibits the activity of protein kinases, which are enzymes that regulate cellular processes. It has been shown to inhibit growth of abnormal cells, such as cancer cells and cells induced to grow abnormally by exposure to cancer therapy. SU5408 also blocks the production of tyrosine kinase and hydroxyindole, which are proteins involved in cell division and proliferation. The drug has been shown to be effective at doses between 0.1-10 μM in inhibiting abnormal cell growth and inducing apoptosis in human cancer cells. SU5408 has also been shown to normalize certain cancer-related genes, which may contribute to its anti-cancer effects.Formula:C18H18N2O3Purity:Min. 95%Molecular weight:310.35 g/molOrotirelin
CAS:Orotirelin is a peptide that is used as a research tool and in the study of protein interactions. Orotirelin binds to orexin receptors, which are found in neurons of the hypothalamus, and activates them. It has been shown to have a potent inhibitory effect on the release of pituitary hormones from the anterior lobe of the pituitary gland. It also acts as an inhibitor for certain ion channels and can be used as an antibody against other ligands that bind to orexin receptors.
Formula:C16H19N7O5Purity:Min. 95%Molecular weight:389.37 g/molDovitinib Lactate Salt
CAS:Dovitinib is a tyrosine kinase inhibitor that is used for the treatment of non-small cell lung cancer, renal cell carcinoma and other cancers. Dovitinib inhibits tumor growth by blocking the cell factor (c-KIT) and the stem cell factor receptor (c-MET). It also inhibits tumor angiogenesis through its inhibition of the colony-stimulating factor 1 receptor (CSF1R), which is involved in regulating hematopoietic stem cells. Dovitinib has been shown to inhibit tumor growth by blocking antiapoptotic genes, such as Bcl2, BclxL, Bfl-1 and Mcl-1. This drug has a terminal half-life of 15 hours.Formula:C24H27FN6O4Purity:Min. 95%Molecular weight:482.51 g/molRoscovitine
CAS:Inhibitor of cyclin-dependend kinases CDC2, CDK2 and CDK5Formula:C19H26N6OPurity:Min. 95%Molecular weight:354.45 g/molSORCS2 antibody
The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.WYE-687
CAS:WYE-687 is a novel small molecule that inhibits lipid kinase activity and is able to induce senescence in cells. It has potent antitumor activity against cancer cells and potently inhibits the growth of xenograft tumors in mice. WYE-687 also possesses potential as a drug target for autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. The drug has been shown to inhibit angiogenesis, which is the formation of new blood vessels from pre-existing ones, both in vitro and in vivo. WYE-687 has been shown to be well tolerated by animals after oral administration, with no observable side effects.Formula:C28H32N8O3Purity:Min. 95%Molecular weight:528.61 g/mol1-Octadecanoyl-2-(15S-hydroxy-5Z,8Z,11Z,13E-eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine
CAS:1-Octadecanoyl-2-(15S-hydroxy-5Z,8Z,11Z,13E-eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine is a bioactive lipid compound, which is derived from natural lipid sources such as cellular membranes. Its mode of action involves participation in complex lipid signaling pathways that play a crucial role in cellular processes. This compound acts as a mediator in signaling cascades associated with inflammation, cellular communication, and homeostasis. As such, it can be integral in studies focused on cell signaling and the physiological roles of lipids.Formula:C43H78NO9PPurity:Min. 95%Molecular weight:784.1 g/molSNX5 protein
SNX5 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been shown to be involved in the regulation of interferon signaling, pneumococcus infection, and growth factor signaling pathways such as TGF-beta. SNX5 protein can be targeted by monoclonal antibodies, including neutralizing antibodies, which can inhibit its activity. Additionally, it has been found to interact with other proteins such as carbonic anhydrase and globulin.Purity:Min. 95%BRDU antibody
BRDU antibody was raised in sheep using highly pure bromodeoxyuridine as the immunogen.Purity:Min. 95%MGP antibody
MGP antibody was raised using the middle region of MGP corresponding to a region with amino acids INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM
Purity:Min. 95%P63, Gst tagged human
CAS:P63, GST tagged human, is a recombinant protein, which is derived from human sources. This product features a glutathione S-transferase (GST) tag, facilitating its purification and use in various experimental settings. The mechanism of action involves the P63 protein, which plays a crucial role in the regulation of gene expression, cellular development, and apoptosis, fused with the GST tag that enables straightforward purification via affinity chromatography.Purity:Min. 95%Pkcε inhibitor scramble peptide
CAS:Please enquire for more information about Pkcε inhibitor scramble peptide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C37H65N9O13Purity:Min. 95%Molecular weight:844 g/mol
