Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL4 antibody, catalog no. 70R-3191</p>

<p>WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML</p>

<p>AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS</p>

<p>The FSHR antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to target the follicle-stimulating hormone receptor (FSHR). This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Mouse monoclonal CISD1 antibody</p>

<p>The TOP2B antibody is a highly specialized product in the field of Life Sciences. It is designed to neutralize the activity of TOP2B, an enzyme involved in DNA replication and repair. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. It has been shown to effectively inhibit the activity of TOP2B in nuclear extracts and interfere with its function. Additionally, this antibody has been found to enhance the effects of interferon and trastuzumab, an anti-HER2 antibody. Its unique properties make it a valuable tool for researchers studying epidermal growth factor signaling, androgen receptor function, and other growth factor pathways. The TOP2B antibody is available for purchase and comes with detailed instructions for use.</p>

<p>Methandriol 3b Conjugate for use in immunoassays</p>

<p>Purified Polyclonal CYSLTR1 antibody</p>

<p>Purified recombinant Human STAMBPL1 protein (His tag)</p>

<p>Myoglobin antibody was raised in rabbit using human heart derived myoglobin as the immunogen.</p>

<p>Purified Polyclonal MAGEA6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2AT4 antibody, catalog no. 70R-6776</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GEM antibody, catalog no. 70R-5974</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The mechanism of action involves binding to DNA-dependent RNA polymerase, which inhibits bacterial growth by preventing transcription and replication. Extensive studies have been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high efficacy. This drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD17 antibody, catalog no. 70R-5074</p>

<p>Purified Polyclonal TFDP1 antibody</p>

<p>Recombinant human SRR protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TGS1 antibody, catalog no. 70R-2563</p>

<p>CBL (167-180) is derived from the CBL E3 ubiquitin ligase which targets receptor tyrosine kinases to lysosome degradation. CBL and its family member CBL-B are expressed in hematopoietic cells and as E3 ubiquitin ligases they contain a tyrosine kinase domain and an RF domain joined by a linker domain. The function of the RF domain is to transfer ubiquitin from E2 ubiquitin-conjugating enzymes onto the target protein which is often phosphorylated. Consequently the ubiquitinated substrate, the receptor tyrosine kinases, are ultimately targeted to the lysosome for degradation.EGFR is an example of a receptor tyrosine kinase whose activation is prevented by CBL and CBL-B when they bind and recruit GRb2, the adapter protein to EGFR. Consequently the ubiquitinylation of EGFR occurs and targets it for recognition by the endosomal protein Complex and then lysosome degradation.It has also been found that the CBL family can negatively regulate through ubiquitinylation, PI 3-kinases, Rap G-protein guanine nucleotide exchange factor (GEF), C3G and Rho GTPase GEF Vav which are all non-receptors.If CBL becomes non-functional it can be associated with malignancies such as acute myeloid leukemia and myelodysplastic syndrome.The Arginine residue at position 14 is isotopically labelled using carbon-13 (6) and nitrogen-14 (4).</p>

<p>APIP antibody was raised in Rabbit using Human APIP as the immunogen</p>

<p>Purified Rabbit polyclonal Nibrin antibody (Ser278)</p>

<p>FOXO1 antibody was raised in Rabbit using Human FOXO1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLG antibody, catalog no. 70R-5384</p>

<p>FOXL2 antibody was raised in mouse using recombinant Human Forkhead Box L2</p>

<p>Rabbit polyclonal SESN1 antibody</p>

<p>DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNE</p>

<p>HKR1 antibody was raised in rabbit using the N terminal of HKR1 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG.</p>

<p>Rabbit polyclonal SAT1 antibody (FITC)</p>

<p>Rosabulin is a conjugate of indibulin and an anticancer drug that selectively targets tumor vasculature. It is a linker that binds to the CD44 receptor on the surface of tumor cells, with human serum albumin as a carrier. The drug has been shown to suppress tumor growth in animal models by binding to CD44 receptors on tumor vessels, inhibiting the formation of new blood vessels necessary for cancer growth. Rosabulin has also been shown to be effective in treating colorectal cancer, lung and breast cancer.</p>

<p>Mouse monoclonal NDEL1 antibody</p>

<p>Purified Rabbit polyclonal Mt41 antibody</p>

<p>Mouse monoclonal TMEM100 antibody</p>

<p>SLC35F3 antibody was raised using the middle region of SLC35F3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW</p>

<p>CD71 antibody was raised in rat using CD71/transferrin receptor as the immunogen.</p>

<p>CDK8 antibody is a monoclonal antibody that specifically targets and neutralizes CDK8, an enzyme involved in cell cycle regulation. This antibody has been extensively tested in various assays and has shown inhibitory effects on CDK8 activity. It has been demonstrated to inhibit the growth of cardiomyocytes and enhance the expression of annexin A2, a protein involved in cell adhesion and apoptosis. Additionally, CDK8 antibody has been shown to modulate the secretion of glucagon, a hormone involved in glucose metabolism. This antibody can be used in research studies and as a tool for investigating the role of CDK8 in various biological processes.</p>

<p>CD8B antibody was raised using the middle region of CD8B corresponding to a region with amino acids KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR</p>

<p>The Cytokeratin 3 Antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and neutralize the leukemia inhibitory factor (LIF), a subtilisin/kexin type protein that plays a crucial role in various cellular processes such as insulin and growth factor signaling, epidermal growth, and fatty acid metabolism. This monoclonal antibody has been extensively validated for its high specificity and sensitivity in detecting and quantifying LIF levels in biological samples. It can be used in various applications including immunohistochemistry, western blotting, enzyme-linked immunosorbent assay (ELISA), and hybridization techniques. With its exceptional performance and reliability, the Cytokeratin 3 Antibody is an indispensable tool for researchers studying LIF-related pathways and exploring potential therapeutic targets for various diseases.</p>

<p>Purified recombinant XG protein (His tag)</p>

<p>5α-Hydroxycostic acid is a sesquiterpene lactone that has been shown to have antiangiogenic effects. It inhibits protein synthesis and cell division, leading to significant cytotoxicity in cells. 5α-Hydroxycostic acid has been shown to inhibit the phosphatase activity of the angiogenic process and to be used as an antiangiogenic therapy for cancer treatment. This compound also inhibits growth factor (e.g., vascular endothelial growth factor) expression, leading to decreased angiogenesis and reduced tumor size in mouse models of cancer. 5α-Hydroxycostic acid also inhibits angiogenesis by reducing the production of chemokines such as monocyte chemoattractant protein 1 (MCP-1).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FZD7 antibody, catalog no. 70R-7269</p>

<p>INHA antibody was raised in Mouse using a purified recombinant fragment of human INHA expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal NGAL antibody (Biotin)</p>

<p>The HDAC2 Antibody is a highly effective tool for studying the role of histone deacetylase 2 (HDAC2) in various cellular processes. This antibody specifically targets HDAC2, a key enzyme involved in the regulation of gene expression through the modification of histone proteins. By binding to HDAC2, this antibody allows for the detection and quantification of HDAC2 levels in cells and tissues.</p>

<p>Mouse monoclonal PPIC antibody</p>

<p>Purified recombinant POMC protein</p>

<p>A1BG antibody was raised in Mouse using a purified recombinant fragment of human A1BG expressed in E. coli as the immunogen.</p>

<p>EIF4E3 antibody was raised using the middle region of EIF4E3 corresponding to a region with amino acids VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MDH2 antibody, catalog no. 70R-1090</p>

<p>Purified Polyclonal CHRNA10 antibody</p>

<p>Rabbit polyclonal NIFK antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication. Studies have shown its high efficacy through a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>HHV-4 Early Antigen Type D C-terminus regions of EBV protein corresponding to amino acids 306-390.</p>

<p>AZD7451 is a research tool that has been used to study the activation, inhibition, and binding of receptors and ion channels. It is an activator of the Ligand-gated ion channel (LGA) receptor. AZD7451 is also an inhibitor of the voltage-gated potassium channel (VGKC) subtype M2, which plays a role in epileptic seizures. The protein interactions of AZD7451 are not well understood but it has been shown to inhibit antibody binding to human cells and peptides.</p>

<p>Mouse monoclonal NGAL antibody (Biotin)</p>

<p>PSTPIP2 antibody was raised in rabbit using the middle region of PSTPIP2 as the immunogen</p>

<p>ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR</p>

<p>IgG Light Chain antibody was raised in Mouse using Rat IgG as the immunogen.</p>

<p>Please enquire for more information about N-Deformyl formoterol-d6 fumarate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>VPS4B antibody was raised in rabbit using the N terminal of VPS4B as the immunogen</p>

<p>The SCARB1 antibody is a specific antibody that is used in immunoassays for various applications in the field of Life Sciences. This polyclonal antibody specifically targets SCARB1, a protein that plays a crucial role in lipid metabolism and cholesterol transport. The SCARB1 antibody can be used in techniques such as flow assays, laser ablation, and polymerase chain reactions to detect and quantify the presence of SCARB1 in samples. It has been validated for use in chemiluminescent immunoassays and can be used with human serum or other biological fluids. With its high specificity and sensitivity, the SCARB1 antibody is an essential tool for researchers studying lipid metabolism and related diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL5 antibody, catalog no. 70R-8319</p>

<p>Purified recombinant MUTY protein (His tag)</p>

<p>Geranylcitronellol is a medicinal compound that has been studied for its potential anticancer properties. It is an analog of geranylgeraniol, a natural product found in Chinese herbs and urine. Geranylcitronellol has been shown to inhibit the growth of cancer cells in human cell lines and induce apoptosis, a process that leads to programmed cell death. This compound also acts as a protein kinase inhibitor, which may contribute to its anticancer activity by disrupting signal transduction pathways involved in tumor growth and progression. The research on this promising compound continues, with the hope of developing new therapies for cancer patients.</p>

<p>Rabbit Polyclonal Synaptotagmin antibody (Ser309)</p>

<p>Purified recombinant ANG protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OAS2 antibody, catalog no. 70R-5885</p>

<p>Rabbit polyclonal WDR19 antibody</p>

<p>Pfkfb2 antibody was raised in rabbit using the C terminal of Pfkfb2 as the immunogen</p>

<p>RPS14 antibody was raised using the middle region of RPS14 corresponding to a region with amino acids GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL</p>

<p>Bromoacetamido-dPEG®11-Azide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®11-Azide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>KIF2B antibody was raised in Rabbit using Human KIF2B as the immunogen</p>

<p>Purified recombinant NMB protein (His tag)</p>

<p>Inhibitor of FGF-1 receptor tyrosine kinase</p>

<p>Recombinant Human CREB3L2 protein (His tag)</p>

<p>SPATA2L antibody was raised using the middle region of SPATA2L corresponding to a region with amino acids SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE</p>

<p>The Cholic Acid Antibody is a highly specialized product in the field of Life Sciences. It is an activated antibody that targets and neutralizes the effects of cholic acid, a potent growth factor involved in various biological processes. This antibody has been extensively studied and proven to be effective against multidrug resistance and autoantibodies associated with certain diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CETP antibody, catalog no. 70R-5415</p>

<p>Mouse monoclonal HMOX2 antibody</p>

<p>Mouse monoclonal LAMB2 antibody</p>

<p>OPRL1 antibody was raised in rabbit using the middle region of OPRL1 as the immunogen</p>

<p>Rabbit polyclonal CASP5 antibody</p>

<p>Rabbit Polyclonal STMN1 antibody (Ser15)</p>

<p>The Moesin antibody is a highly specialized product used in the field of Life Sciences. It is derived from hybridoma cells and is colloidal in nature. This antibody is reactive towards aldehyde groups and can be used for various applications such as protein inhibition studies, detecting specific proteins, and studying protein kinase activity.</p>

<p>NUP153 antibody was raised in mouse using nuclear matrix protein fraction prepared from rat liver nuclei as the immunogen.</p>

<p>Mouse serum albumin antibody was raised in rabbit using mouse serum albumin as the immunogen.</p>

<p>Rabbit polyclonal HIBADH antibody</p>

<p>CTAG1A antibody was raised in Rabbit using Human CTAG1A as the immunogen</p>

<p>KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids TQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC653135 antibody, catalog no. 70R-9058</p>

<p>Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody</p>

<p>Rabbit polyclonal PDCL2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POSTN antibody, catalog no. 70R-6070</p>

<p>Rabbit polyclonal Peroxiredoxin 1 antibody (biotin)</p>

<p>Zdhhc11 antibody was raised in rabbit using the middle region of Zdhhc11 as the immunogen</p>

<p>CD3E antibody was raised in Mouse using a purified recombinant fragment of CD3E expressed in E. coli as the immunogen.</p>

<p>AK2 antibody was raised in Rabbit using Human AK2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HPD antibody, catalog no. 70R-2553</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH3A1 antibody, catalog no. 70R-9874</p>

<p>Rabbit Polyclonal LDLRAD1 antibody</p>