Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,559 products)
- By Biological Target(101,029 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SYDE1 antibody
SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGGPDK1 antibody
The PDK1 antibody is a monoclonal antibody that targets the growth factor receptor PDK1. It specifically binds to the antigen expressed on the surface of cells and inhibits the activation of PDK1, which plays a crucial role in cell growth and survival. This antibody has been shown to block the binding of vitronectin, glucagon, galactose, and chemokines to PDK1, thereby preventing downstream signaling pathways associated with cell proliferation. The PDK1 antibody is a potent family kinase inhibitor that can be used in research studies to investigate the role of PDK1 in various cellular processes. It has also shown promising results in preclinical studies as a potential therapeutic target for diseases such as cancer. Additionally, this antibody can be used in combination with other targeted therapies, such as cetuximab or epidermal growth factor receptor (EGFR) inhibitors, to enhance their efficacy. The PDK1 antibody is available as a high-quality monoclonal antibodyPDXK antibody
PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKBD140 [for Albumin binding assay]
CAS:BD140 is a peptide that is used as a research tool for studying protein interactions. It can be used in immunoassays to detect antibody-antigen interactions and has been reported to inhibit the binding of bovine serum albumin to an antibody. This product is also useful for research in cell biology, ligand-receptor interactions, pharmacology, and ion channels. BD140 is a high-purity product with CAS number 1201643-08-4.Formula:C21H21BF2N2OPurity:Min. 95%Molecular weight:366.22 g/molPIK3IP1 antibody
PIK3IP1 antibody was raised using the middle region of PIK3IP1 corresponding to a region with amino acids QALPAFTTEIQEASEGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVPurity:Min. 95%ENTPD8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENTPD8 antibody, catalog no. 70R-6382Purity:Min. 95%Mouse PMN antibody
Mouse PMN antibody was raised in rabbit using mouse PMNs as the immunogen.Purity:Min. 95%SGMS2 antibody
SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYPurity:Min. 95%GNL3 antibody
GNL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR
HIV1 antibody (HTLV3) (HRP)
HIV1 antibody (HTLV3) (HRP) was raised in goat using human isolate as the immunogen.RGS16 antibody
RGS16 antibody is a monoclonal antibody that specifically targets and inhibits the activity of RGS16 protein. RGS16 is involved in various cellular processes, including growth factor signaling, apoptosis, and immune response. By binding to RGS16, this antibody prevents its activation and cytotoxic effects. It also interferes with the formation of RGS16 dimers, which are necessary for its function. This monoclonal antibody has been shown to be effective in inhibiting the growth of Mycoplasma genitalium, a bacterium associated with various reproductive disorders. Additionally, it has potential therapeutic applications in autoimmune diseases where autoantibodies target RGS16 or its interacting proteins. The use of this antibody may provide insights into the role of RGS16 in different cellular pathways and contribute to the development of novel treatments.Rabbit anti Dog IgG (biotin)
Rabbit anti-dog IgG (biotin) was raised in rabbit using canine IgG F(c) fragment as the immunogen.Purity:Min. 95%PCDHA12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHA12 antibody, catalog no. 70R-6159Purity:Min. 95%JNJ-17203212
CAS:JNJ-17203212 is a pharmacological compound, specifically a selective antagonist of the transient receptor potential vanilloid 1 (TRPV1) receptor. This compound is derived from synthetic chemical processes, emphasizing its role in modulating ion channel activity. The TRPV1 receptor is a non-selective cation channel expressed predominantly in sensory neurons.Formula:C17H15F6N5OPurity:Min. 95%Molecular weight:419.32 g/molFGF14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FGF14 antibody, catalog no. 70R-9286Purity:Min. 95%ML 3403
CAS:ML 3403 is a small-molecule inhibitor that targets specific protein kinases, designed for biochemical and cellular research. It is a synthetic compound derived through rigorous medicinal chemistry optimization, focusing on achieving high specificity and potency. The mode of action involves competitive inhibition of the ATP-binding sites of targeted kinases, thereby blocking their catalytic activity and subsequent signaling pathways.Formula:C23H21FN4SPurity:Min. 95%Molecular weight:404.5 g/molUCP5 antibody
UCP5 antibody was raised in rabbit using a 16 amino acid peptide from rat UCP5 as the immunogen.Purity:Min. 95%LDL protein
LDL protein is a crucial component in the field of Life Sciences. It is commonly used for various research purposes, including the development of monoclonal antibodies and proteins. LDL protein is known for its low density and colloidal properties, making it an ideal candidate for experiments involving natriuretic activities or electrode studies.
Purity:Min. 95%TOM1 antibody
TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAWarfarin antibody
The Warfarin antibody is a specialized polyclonal antibody that targets and neutralizes the effects of Warfarin, a commonly used anticoagulant medication. This antibody specifically binds to Warfarin and prevents its interaction with collagen, which is essential for the formation of blood clots. It has been extensively tested in both in vitro and in vivo studies, demonstrating high affinity and specificity for Warfarin. The Warfarin antibody can be used in various research applications within the field of life sciences, including but not limited to the study of atypical hemolytic disorders, human serum albumin interactions, and growth factor signaling pathways. With its unique properties and potential therapeutic applications, this antibody is a valuable tool for researchers in need of reliable and effective means to study and manipulate Warfarin-related processes.Purity:Min. 95%PACSIN1 antibody
The PACSIN1 antibody is a highly specific monoclonal antibody that has been extensively tested and validated for use in various life science research applications. This antibody is particularly useful for studying the role of PACSIN1, a protein involved in diverse cellular processes such as endocytosis, vesicle trafficking, and cytoskeletal dynamics.FBXL5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL5 antibody, catalog no. 70R-2735Purity:Min. 95%MAP2K7 antibody
MAP2K7 antibody was raised using the middle region of MAP2K7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLYPEL5 antibody
YPEL5 antibody was raised in rabbit using the N terminal of YPEL5 as the immunogenPurity:Min. 95%NME4 antibody
NME4 antibody was raised using the middle region of NME4 corresponding to a region with amino acids VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVThalidomide-o-C8-NH2
CAS:Please enquire for more information about Thalidomide-o-C8-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C21H27N3O5Purity:Min. 95%Molecular weight:401.5 g/molNTNG1 antibody
The NTNG1 antibody is a monoclonal antibody that targets the NTNG1 protein. It plays a crucial role in various cellular processes such as fas-mediated apoptosis, collagen synthesis, and iron homeostasis. This antibody specifically binds to the NTNG1 protein, which is involved in cell growth and development. By binding to this target molecule, the NTNG1 antibody induces apoptosis in activated cells and inhibits their growth. Additionally, it has cytotoxic effects on cancer cells and has been used in research studies in the field of Life Sciences. The NTNG1 antibody can also be used for diagnostic purposes to detect autoantibodies or as a tool for studying iron metabolism and ferritin synthesis.TSKS antibody
TSKS antibody was raised in rabbit using residues 577-592 of the human TSKS protein as the immunogen.Purity:Min. 95%ZNF14 antibody
ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQCMAP3K1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K1 antibody, catalog no. 70R-2358Purity:Min. 95%Goat anti Human IgG (H + L) (Fab'2) (rhodamine)
Goat anti-human IgG (H + L) (Fab'2) (rhodamine) was raised in goat using human IgG whole molecule as the immunogen.
Purity:Min. 95%CTACK protein
Region of CTACK protein corresponding to amino acids FLLPPSTACC TQLYRKPLSD KLLRKVIQVE LQEADGDCHL QAFVLHLAQR SICIHPQNPS LSQWFEHQER KLHGTLPKLN FGMLRKMG.Purity:Min. 95%1-Methylestrone
CAS:Controlled Product1-Methylestrone is a chemical compound with the molecular formula C14H18O2. It is an estrogenic metabolite of estradiol, and is formed from the metabolism of estradiol by CYP1A2 and other cytochrome P450 enzymes. 1-Methylestrone has been shown to be an activator of certain estrogen receptors, such as ERα and ERβ, in breast cancer cells. 1-Methylestrone also has been shown to inhibit the production of cyclic AMP by phosphodiesterase 4B (PDE4B) in prostate cancer cells, which may be due to its ability to inhibit protein interactions.Formula:C19H24O2Purity:Min. 95%Molecular weight:284.4 g/molC1orf102 antibody
C1orf102 antibody was raised using the N terminal of C1orf102 corresponding to a region with amino acids ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQCA 242 antibody
The CA 242 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to amyloid plaques, which are abnormal protein deposits commonly found in the brains of individuals with neurodegenerative diseases such as Alzheimer's.SLC9A7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC9A7 antibody, catalog no. 70R-7309Purity:Min. 95%SURF4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SURF4 antibody, catalog no. 70R-6349
Purity:Min. 95%CD14 antibody
The CD14 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and bind to CD14, a protein that plays a crucial role in the immune response. This antibody has been extensively studied and proven to be highly effective in various immunoassays and research applications.KCTD7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD7 antibody, catalog no. 70R-5085Purity:Min. 95%CBZ-N-Amido-dPEG®3-Amine
CAS:CBZ-N-Amido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CBZ-N-Amido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C25H53NO12Purity:Min. 95%Molecular weight:559.69 g/molZFP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP3 antibody, catalog no. 70R-8144Purity:Min. 95%FGF acidic antibody
FGF acidic antibody was raised in rabbit using highly pure recombinant human FGF-acidic as the immunogen.Purity:Min. 95%ARI-3099 hydrochloride
CAS:ARI-3099 hydrochloride is a peptide that is used as a research tool for studying ion channels and protein interactions. This peptide has been shown to activate the receptor and ligand, which leads to pharmacological effects. ARI-3099 hydrochloride is an inhibitor of protein interactions. It binds to the receptor and ligand, preventing the formation of protein complexes. ARI-3099 hydrochloride is also an inhibitor of ion channels and can be used as a research tool for studying these channels in cell biology.Formula:C13H17BClN3O4Purity:Min. 95%Molecular weight:325.56 g/molJMJD2C antibody
JMJD2C antibody was raised in rabbit using the middle region of JMJD2C as the immunogenPurity:Min. 95%STAT6 antibody
The STAT6 antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the STAT6 protein. This protein plays a crucial role in the regulation of various cellular processes, including immune response and cell growth. By specifically binding to STAT6, this antibody effectively blocks its activity, preventing the downstream signaling pathways from being activated.Purity:Min. 95%NXF5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NXF5 antibody, catalog no. 70R-8491Purity:Min. 95%TFAM antibody
The TFAM antibody is a cytotoxic antibody that is commonly used in Life Sciences research. It specifically targets and binds to the transcription factor A, mitochondrial (TFAM), which plays a crucial role in the regulation of mitochondrial DNA replication and transcription. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting TFAM in various experimental settings.Purity:Min. 95%SPDP-dPEG®24-NHS Ester
CAS:SPDP-dPEG®24-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®24-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C37H60N4O20Purity:Min. 95%Molecular weight:880.89 g/molSPATA9 antibody
SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK
Purity:Min. 95%RAB5A antibody
The RAB5A antibody is a specific antibody that targets the RAB5A protein, which plays a crucial role in cell-extracellular matrix interactions. This polyclonal antibody is widely used in Life Sciences research to study the function and regulation of RAB5A. It has been extensively characterized using various chromatographic techniques to ensure high purity and specificity. The RAB5A antibody can be used for immunohistochemistry, immunofluorescence, and western blotting applications. It recognizes both native and denatured forms of RAB5A and has been validated for use in multiple species. This monoclonal antibody is an essential tool for researchers studying biomolecules, such as collagen and hyaluronan receptors, as well as their interactions with other cellular components. With its high affinity and sensitivity, the RAB5A antibody enables accurate detection and quantification of activated RAB5A in various biological samples, including blood plasma and isolated nucleic acids. Trust thisUbiquilin 1 antibody
Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTAMAX antibody
MAX antibody was raised in mouse using recombinant Human Helix-Loop-Helix Zipper Protein (Max)C1ORF103 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf103 antibody, catalog no. 70R-4298Purity:Min. 95%Rabbit anti Sheep IgG (H + L) (FITC)
Rabbit anti-sheep IgG (H+L) (FITC) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%Collagen Type V antibody
Collagen type V antibody was raised in rabbit using collagen type V from human and bovine placenta as the immunogen.Purity:Min. 95%SRPR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRPR antibody, catalog no. 70R-5028Purity:Min. 95%ANKS3 antibody
ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGWGLUT2 antibody
GLUT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTPurity:Min. 95%CENPM antibody
CENPM antibody was raised using the middle region of CENPM corresponding to a region with amino acids CDLEVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDLGPT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPT antibody, catalog no. 70R-1194Purity:Min. 95%MAGEB4 antibody
MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGDRSV antibody
RSV antibody was raised in mouse using fusion protein of RSV, types A and B as the immunogen.
![BD140 [for Albumin binding assay]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FBYB64308.webp&w=3840&q=75)
