Biochemicals and Reagents

<p>Purified recombinant Human TACSTD2 protein (His tag)</p>

<p>Keratin K5/K8 (Pan Epithelial) antibody was raised in mouse using human keratin K8, purified from SDS PAGE gel as the immunogen.</p>

<p>IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK</p>

<p>Mouse monoclonal GDAP1L1 antibody</p>

<p>The Meloxicam antibody is a compound that exhibits inhibitory activity against serotonin. It is an antibody that specifically targets and inhibits the production of serotonin, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent for various conditions. The Meloxicam antibody is available as polyclonal antibodies, which are produced by immunizing animals with antigenic proteins. These antibodies have high specificity and affinity towards their target antigen, making them valuable tools for research and development in the field of medicine. Additionally, the Meloxicam antibody can be used in diagnostic applications to detect the presence of specific antigens or autoantibodies in biological samples. Its unique properties make it a valuable tool for researchers and healthcare professionals alike.</p>

<p>Rabbit polyclonal UBE2G2 antibody</p>

<p>CCR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE</p>

<p>Purified recombinant ARFIP2 protein (His tag)</p>

<p>Purified recombinant FAIM protein (His tag)</p>

<p>Mouse monoclonal PRKY antibody</p>

<p>PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE</p>

<p>FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI</p>

<p>Rabbit polyclonal Collagen XII alpha 1 antibody</p>

<p>CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM</p>

<p>GJA3 antibody was raised in Rabbit using Human GJA3 as the immunogen</p>

<p>Purified Native Bordetella pertussis toxin protein</p>

<p>The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.</p>

<p>Purified recombinant REXO1 protein (His tag)</p>

<p>The West Nile virus antibody is a highly effective neutralizing agent that can be used for the detection and treatment of West Nile virus infections. It has been shown to bind to specific viral proteins, preventing the virus from entering host cells and replicating. This antibody is produced using advanced monoclonal antibody technology, ensuring high specificity and potency. In addition to its antiviral properties, this antibody has also been demonstrated to have other beneficial effects. It can activate various immune responses, such as chemokine production and fibrinogen activation, which are essential for controlling viral infections. Furthermore, it has been found to have potential therapeutic applications in the treatment of certain cancers, as it exhibits anti-mesothelin and alpha-fetoprotein activities. With its wide range of applications in both diagnostics and therapeutics, this West Nile virus antibody is an invaluable tool in the field of life sciences.</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>Rabbit polyclonal TMEM175 antibody</p>

<p>The CD34 antibody is a growth factor that plays a crucial role in microvessel density. This antibody is buffered and colloidal, making it ideal for use in various applications within the Life Sciences field. It is classified as a monoclonal antibody, which means it specifically targets a biomolecule of interest. The CD34 antibody has neutralizing properties and can be used as an immunosuppressant in certain cases. Its effectiveness can be measured through techniques such as electrophoresis and immunoassays. Additionally, this monoclonal antibody has been shown to interact with calmodulin, further highlighting its versatility and potential applications.</p>

<p>CANX antibody was raised in rabbit using the C terminal of CANX as the immunogen</p>

<p>CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT</p>

<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>

<p>The SYT1 antibody is a monoclonal antibody that specifically targets the Synaptotagmin-1 (SYT1) antigen. It is widely used in Life Sciences research for various applications, including the detection and analysis of SYT1 expression in cells and tissues. This antibody has been shown to have high specificity and sensitivity, making it a valuable tool for studying the role of SYT1 in synaptic transmission, neurotransmitter release, and other cellular processes.</p>

<p>CD100 antibody was raised in rabbit using residues 147-158 [GKNEDGKGRCPF] of the human CD100 protein as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>SOD antibody was raised in rabbit using bovine superoxide dismutase as the immunogen.</p>

<p>Rabbit polyclonal UBA7 antibody</p>

<p>Rabbit polyclonal OR9A2 antibody</p>

<p>PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD</p>

<p>GPR52 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal FOXN4 antibody</p>

<p>Purified recombinant HCVE2 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Trpv6 antibody, catalog no. 70R-8072</p>

<p>The BMP2 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of bone morphogenetic protein 2 (BMP2), a key regulator of various cellular processes. This antibody specifically binds to activated BMP2, preventing its interaction with cellular receptors and downstream signaling pathways.</p>

<p>Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY</p>

<p>The BID antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets specific chemokines and has been extensively studied in the field of Life Sciences. The BID antibody has shown great potential in various applications, including lysis assays, glycosylation studies, and as a tool for detecting specific proteins in research experiments. This monoclonal antibody has been used to study the role of epidermal growth factor (EGF) signaling pathway and its interaction with β-catenin and caspase-9. Additionally, it has been used as a diagnostic tool for detecting anti-dnp antibodies and as a therapeutic agent in the treatment of HER2-positive breast cancer alongside trastuzumab. With its high specificity and versatility, the BID antibody is an invaluable tool for researchers in various fields.</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR</p>

<p>ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogen</p>

<p>Rabbit polyclonal MNK1 antibody (Thr250)</p>

<p>Rabbit polyclonal SYT9 antibody</p>

<p>EsxB protein is a highly specialized and unique molecule that has various applications in the field of Life Sciences. It can be used as a cholinergic agent, a component in DNA vaccines, and as a target for mouse monoclonal antibodies. The EsxB protein can be detected using techniques such as polymerase chain reaction (PCR) or flow immunoassays with streptavidin-coated paramagnetic particles. Recombinant forms of EsxB protein are available for research purposes.</p>

<p>MYH2 antibody was raised in Rabbit using Human MYH2 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>IL8 antibody was raised in mouse using recombinant human IL-8 as the immunogen.</p>

<p>Donkey anti Sheep IgG (H + L) secondary antibody (HRP) conjugated</p>

<p>Rabbit polyclonal SDSL antibody</p>

<p>Rabbit polyclonal ARHGEF2 antibody</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>The IRF4 antibody is a polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to the Interferon Regulatory Factor 4 (IRF4), a protein involved in various cellular processes. This antibody is commonly used in research to study the role of IRF4 in different biological systems.</p>

<p>Atagabalin is a novel pharmaceutical compound, which is derived from marine biological sources. Its primary mode of action involves the inhibition of the alpha-2-delta subunit of voltage-gated calcium channels. This mechanism modulates synaptic transmission, leading to reduced neuronal excitability.</p>

<p>The CA9 antibody is a monoclonal antibody that has been extensively studied in the field of Life Sciences. It has shown promising results in various applications, including its ability to neutralize aldehyde and interferon autoantibodies. This antibody has a high affinity for low-density albumin and acidic proteins, making it an excellent tool for research purposes. Additionally, the CA9 antibody has been used in studies related to collagen and growth factors, further highlighting its versatility in the field of molecular biology. With its exceptional specificity and binding capacity, this monoclonal antibody is a valuable asset for any laboratory or research facility.</p>

<p>The KRT5 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the keratin 5 (KRT5) protein, which is commonly found in collagen-rich tissues. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>Rabbit polyclonal CaMKII antibody (Thr305)</p>

<p>Goat anti-syrian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>Purified Polyclonal Adenylate Cyclase 1 antibody</p>

<p>P53 Monoclonal Antibody (HRP)</p>

<p>Rabbit polyclonal CDK7 antibody</p>

<p>CALD1 antibody was raised in Rabbit using Human CALD1 as the immunogen</p>

<p>The DEP1 antibody is a powerful inhibitory factor that belongs to the family of antibodies. It interacts with mitogen-activated proteins and annexin A2, playing a crucial role in various life sciences applications. This antibody exhibits strong DNA binding activity and has been extensively studied in the context of leukemia inhibitory factor (LIF) signaling pathways. Through its ability to regulate polymerase chain reactions and adenosine A1 receptors, the DEP1 antibody influences cytokine production and transmembrane conductance. With its high specificity and potency, this polyclonal antibody is an essential tool for researchers in the field of life sciences.</p>

<p>CD137 antibody was raised in goat using highly pure recombinant human 4-1BB receptor as the immunogen.</p>

<p>Rabbit polyclonal TEX10 antibody</p>

<p>The APLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it versatile for various research purposes. This antibody specifically targets APLP1, which stands for amyloid precursor-like protein 1. APLP1 is involved in various cellular processes, including retinoid metabolism and methyl transferase activity.</p>

<p>Thiabendazole Conjugate for use in immunoassays</p>

<p>This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.</p>

<p>The TRKC antibody is a water-soluble monoclonal antibody used in Life Sciences. It is specifically designed to target and bind to the TRKC receptor, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to have high affinity and specificity for its target.</p>

<p>Sheep polyclonal Triamcinolone Acetonide antibody</p>

<p>The FADD antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target the Fas-associated death domain (FADD) protein, which plays a crucial role in cell signaling and apoptosis. This antibody has been extensively validated for its specificity and sensitivity in various applications.</p>

<p>The HSPBP1 antibody is a highly specialized product used in the field of Life Sciences. It is an activated antibody that has been developed to specifically target and bind to HSPBP1, a metal-binding protein involved in various cellular processes. The antibody can be used for a range of applications, including research studies, diagnostic assays, and therapeutic purposes.</p>

<p>MRPL24 antibody was raised in Rabbit using Human MRPL24 as the immunogen</p>

<p>Substance P antibody was raised in guinea pig using duplicated N-Terminus of perilipin as the immunogen.</p>

<p>BIRC3 antibody was raised in Rabbit using Human BIRC3 as the immunogen</p>

<p>Purified recombinant GFRA3 protein (His tag)</p>

<p>The Caspase 7 antibody is a powerful inhibitory factor used in Life Sciences research. This polyclonal antibody specifically targets the protein caspase 7, which plays a crucial role in programmed cell death (apoptosis). By blocking the activity of caspase 7, this antibody allows researchers to investigate its function and explore its potential as a therapeutic target.</p>

<p>Rabbit polyclonal FUS antibody (biotin)</p>

<p>CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PETQPMLSTADKSSDSSSPERASAQSSTEKLIRPSSLQKPSIPNSAGKLT</p>

<p>Nalidixic Acid Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal SLC27A2 antibody</p>

<p>Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>Rabbit polyclonal PASP antibody</p>

<p>HSPA2 antibody was raised using the middle region of HSPA2 corresponding to a region with amino acids ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK</p>

<p>The PON1 antibody is a monoclonal antibody used in Life Sciences research. It is designed to neutralize the activity of acetylcholine esterase, an enzyme involved in cholinergic neurotransmission. By binding to and inhibiting this enzyme, the PON1 antibody can modulate the effects of acetylcholine in various biological processes. Additionally, this antibody has been shown to react with other targets such as levothyroxine, interleukin-6, and acetyltransferase. It may also have potential applications in studying autoimmune disorders characterized by the production of autoantibodies against basic proteins like collagen and cytokines like TNF-α. With its specificity and versatility, the PON1 antibody is a valuable tool for researchers exploring the intricacies of cholinergic signaling and related pathways.</p>

<p>Purified Polyclonal CaMK2 delta antibody</p>

<p>Purified Recombinant NARS protein (His tagged)</p>

<p>Rabbit polyclonal beta Enolase antibody</p>

<p>Rabbit polyclonal GATA4 antibody (Ser105)</p>

<p>Rabbit Polyclonal OR2M7 antibody</p>

<p>C1ORF184 antibody was raised using the C terminal Of C1Orf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV</p>

<p>The CD3 antibody is a highly effective and versatile tool used in Life Sciences. It is a monoclonal antibody that specifically targets CD3, a protein found on the surface of T cells. This antibody is widely used in research and diagnostic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA8 antibody, catalog no. 70R-2586</p>

<p>Sheep polyclonal Methaqualone 6 antibody</p>

<p>Hepatitis C virus antibody was raised in mouse using highly pure HCV NS5a as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth by preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>