Biochemicals and Reagents

<p>Peptide Ac-AKFVAAWTLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-QAVYKQTMLF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QAVYKQTMLF-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QAVYKQTMLF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QAVYKQTMLF-OH at the technical inquiry form on this page</p>

<p>Peptide H-STSGGTAALGCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IFFYDSENPPASEVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-E^V^D^P^I^G^HL^Y^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Lauric Acid-HNKHLPSTQPLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-KAQPAQPADEPAE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-SVLLKHSKADGLAGSRHRYA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVLLKHSKADGLAGSRHRYA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVLLKHSKADGLAGSRHRYA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVLLKHSKADGLAGSRHRYA-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-LNCLWLRPQPIFLWKLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LNCLWLRPQPIFLWKLR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LNCLWLRPQPIFLWKLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LNCLWLRPQPIFLWKLR-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VNFYAWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Fluor-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EEQY^NSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ITDFGLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-KKLNRTLSFAEPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-ILRTQESEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GTPTAENPEYLGLDVPV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-CGGRRRLLIYYTSRRR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGRRRLLIYYTSRRR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGRRRLLIYYTSRRR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGRRRLLIYYTSRRR-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-LTSELPGWLQANRHVKPTGS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Inhibitor of FGFR kinase</p>

<p>H-VEREKRAVGLGALFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VEREKRAVGLGALFL-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VEREKRAVGLGALFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VEREKRAVGLGALFL-OH at the technical inquiry form on this page</p>

<p>Peptide B-Ahx-APRTPGGRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-GITNIN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IWLDNVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Inhibitor of CETP exchange protein</p>

<p>Peptide H-DREQAPNL^VY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>SARS-CoV-2 Positive Human Nasal Swab (UTM) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-2 Positive Human Nasal Swab (UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-ETLLQDFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-YGGFLRRIRPKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-R^TPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-S^LS^LSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GTTLITNLSSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about H-Orn-Hyp-Myristoil2 · 2HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide Ac-CEQKLISEEDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NEPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Azide-IELLQARC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ILSP^FLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Aurora kinase inhibitor</p>

<p>Peptide H-QKSDDDYEDYASNKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-MYWVRQAPGKGLEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-GLAG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-YAVTDAVLAPHI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YAVTDAVLAPHI-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YAVTDAVLAPHI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YAVTDAVLAPHI-OH at the technical inquiry form on this page</p>

<p>Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GNFHAVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TDELFQIEGLKEELAYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>NBQX is a competitive antagonist of ionotropic glutamate receptors of AMPA and kainate subfamilies. It has been reported anti-convulsant activity in seizures models induced by electrostimulation, drugs or genetic predisposition.</p>

<p>Peptide H-AIWNVINWENVTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HYGGLTGLNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-RHRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VVMQYADSGSHFVPREATKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VVMQYADSGSHFVPREATKK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VVMQYADSGSHFVPREATKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VVMQYADSGSHFVPREATKK-OH at the technical inquiry form on this page</p>

<p>Peptide H-SANILLDEAFTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VNSAAFPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DISEMFLQIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Carcinoembryonic Antigen (CEA), Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Digoxin Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Follicle Stimulating Hormone (FSH) F(ab)’2 Fragment Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-NNYMYAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-SLRRYP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FNLAGNHEQEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ELLRSFFYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MAL^NSEALSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Testosterone-COOH Conjugate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LGVSCEVIDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HRK-Y is a synthetic BH3 peptide that selectively antagonizes BCL-XL, a pro-survival protein of the Bcl-2 family. This interaction disrupts the balance of Bcl-2 family proteins, leading to cytochrome c release and subsequent apoptosis in susceptible cancer cells. HRK-Y is utilized in BH3 profiling assays to assess the sensitivity of cancer cells to BH3-mimetic drugs and to identify potential synergistic effects with NK cell-based therapies.</p>

<p>Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-K^LVVVGAVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DAEFR^HDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLDEVTYLEASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EQQCVIMAENR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WYQNMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GTFASLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide PB-PKKKRKV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-GGLVQPGGSLRLSCAASGFTF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EDLAALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WYQSMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Inhibitor of cyclin dependend kinases</p>

<p>H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-EVGDWRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TPVSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FLPLIGRVLSGIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QGGFLGLSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-CEPLEKQHEKERKQEEGES is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-RFAAKAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Oxybutynin is an antimuscarinic agent that is used to aid the bladder in relaxing and preventing the urge to void. This drug is used in the treatment of an overactive bladder and reduces detrusor muscle activity. Oxybutynin works by inhibiting the action of acetylcholine on smooth muscle.</p>

<p>Peptide Aoa-ATCYCRTGRCATRESLSGVCEISGRLYRLCCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CTPYDINQM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WVDGTDYETGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPLTTPVGGGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PVDEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>A novel non-covalent inhibitor of the PLpro protease from SARS-CoV-2 and SARS-CoV viruses. GRL 0617 inhibits the proteolytic processing of the viral polypeptide. As PLpro also acts as a protease in pathways involved in innate immunity, there are indications that it can promote immunity against the virus.</p>

<p>Opioid receptor antagonist</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-SHAVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TPSLPTPPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Brazilein is a cationic peptide isolated from the venom of the Brazilian pit viper, Bothrops jararaca. It has been shown to activate voltage-gated sodium channels, and inhibit potassium channels. Brazilein has also been shown to bind to a variety of different receptors, including muscarinic acetylcholine (mACh) receptors and serotonin 5HT2A receptors. Brazilein is used as a research tool for investigating protein interactions, as well as various other fields in life science such as pharmacology and cell biology. Brazilein is purified with high purity and has a low molecular weight. It can be used as an inhibitor or activator depending on the requirements of the experiment.</p>

<p>The immunoglobulin IgE, is produced by plasma cells in response to antigenic stimuli. Measurement of total serum IgE is often used as a tool in the diagnosis and management of atopic diseases such as asthma, hay fever, atopic dermatitis and urticaria. It has been used to distinguish atopic from non-atopic individuals presenting allergy-like symptoms. In addition, studies have also shown that increased levels of IgE in cord blood and infants may be predictive of future atopic tendencies.<br>Normal levels of circulating IgE are extremely low in comparison to other immunoglobulins. Levels of IgE at birth are almost undetectable but increase in non-allergic adults. Elevated levels are commonly seen in cases of allergic diseases, parasitic infections, pulmonary aspergillosis, Wiskott-Aldrich syndrome, and myeloma. Myeloma IgE serum has been the raw material of choice for many years for manufacturers of IgE control and calibrators. Locating this natural product can be challenging and often companies are forced to hold large volumes in stock or face potential out of stock situation.<br>Compared to native myeloma plasma, this IgE cell culture derived product has the distinct advantage of always being available. The material is derived from a human myeloma cell line which means that lot to lot consistency is guaranteed without having to worry about relying on a donor and all of the concerns that can accompany a natural product.</p>

<p>Peptide H-ADFPTPSISDFEIPTSNIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TETSQVAPA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YMVIQGEPGAVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CGKGLSATVTGGQK^GRGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VAVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VEIFYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>PCP antibody is a glycosylated protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research as a tool to study the function of the PCP pathway. This pathway is involved in cell polarity and tissue development.</p>

<p>H-EGVTVLINEDK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EGVTVLINEDK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EGVTVLINEDK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EGVTVLINEDK-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-NLWAAQRYGRELRRMSDEFVDSFKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PIIHFGSDYEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-QRPIF^IITEYMANGCLLNYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-QHSQITKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VHEHGGGKPI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VHEHGGGKPI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VHEHGGGKPI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VHEHGGGKPI-OH at the technical inquiry form on this page</p>

<p>Peptide H-TAVNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>17:0-20:4 PI (3,4,5) P3 is a synthetic phosphoinositide, a type of lipid molecule, which is typically derived from chemical synthesis using specialized lipid chemistry techniques. This product is designed to mimic natural phosphoinositides found within the cellular membranes. Its mode of action involves acting as a substrate for studying kinase activities and phosphatase interactions within signaling pathways. 17:0-20:4 PI (3,4,5) P3 plays a critical role in cellular signaling by serving as a docking site for signaling proteins with specific lipid-binding domains, influencing downstream signaling pathways.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-RCPQEGFDHRDSKVS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RCPQEGFDHRDSKVS-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RCPQEGFDHRDSKVS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RCPQEGFDHRDSKVS-OH at the technical inquiry form on this page</p>

<p>Peptide H-EQLSSVSSF^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VEPQKFAEELIHRLERVQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VEPQKFAEELIHRLERVQ-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VEPQKFAEELIHRLERVQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VEPQKFAEELIHRLERVQ-OH at the technical inquiry form on this page</p>

<p>Dengue Virus IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Dengue Virus IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-SLQPPPPNPNSKDPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SLQPPPPNPNSKDPR-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SLQPPPPNPNSKDPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SLQPPPPNPNSKDPR-OH at the technical inquiry form on this page</p>

<p>Albumin Goat Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Albumin Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LGGDLGTYVINK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.</p>

<p>Peptide H-GQSEVSAAQLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LFLQFGAQGSPFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TPSLPTPPTREPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-ALELLMAANFLDC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALELLMAANFLDC-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALELLMAANFLDC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALELLMAANFLDC-OH at the technical inquiry form on this page</p>

<p>H-CVADPDHDHTGFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CVADPDHDHTGFL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CVADPDHDHTGFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CVADPDHDHTGFL-OH at the technical inquiry form on this page</p>

<p>Perindopril t-butylamine salt inhibits the angiotensin converting enzyme (ACE) to prevent the conversion of angiotensin I to angiotensin II. When used in drug formulations, it has been shown to decrease blood pressure in patients with congestive heart failure. Perindopril also has an effect on the renin-angiotensin system, which regulates blood pressure and fluid homeostasis by promoting vasoconstriction and increasing salt and water retention.<br>Perindopril t-butylamine salt is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready to use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GLEWVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-SEQAAEAMEV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SEQAAEAMEV-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SEQAAEAMEV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SEQAAEAMEV-OH at the technical inquiry form on this page</p>

<p>Parvovirus B19 C-Terminal Fragment of VP2, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Parvovirus B19 C-Terminal Fragment of VP2, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LLDLLEGLTGQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VLAIDHLNEDQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YISPDQLADLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SASLHL^PK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-RARADADARARADADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Potent inhibitor of mitotic spindle 1 (MSP1) kinase. MPS1 is a component of the spindle assembly checkpoint and is therefore involved in mitosis. Targeting MSP1 kinases has therapeutic applications in cancer and data suggests good efficacy in vivo when combining BOS 172722 with paclitaxel.</p>

<p>Peptide H-TTPPVLDSDGSFFLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Procalcitonin (PCT), Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Procalcitonin (PCT), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-QGVDDAFYTLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>