Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,185 products)
- By Biological Target(99,150 products)
- By Pharmacological Effects(6,789 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,764 products)
- Secondary Metabolites(14,307 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Aoa-SMFVYGGCQGNNNNFQSKANC-NH2
<p>Peptide Aoa-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPNALTDDR^-OH
<p>Peptide H-VPNALTDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLVEELPLR^-OH
<p>Peptide H-LLVEELPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALVILAK^-OH
Peptide H-ALVILAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVDGYVKPQIK^-OH
<p>Peptide H-AVDGYVKPQIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BD-2, recombinant Human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C188H305N55O50S6Molecular weight:4,328.23 g/molH-NGLHLPSYSPYPR^-OH
<p>Peptide H-NGLHLPSYSPYPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2
<p>Peptide H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-LRRFSTAPFAFIDINDVINF-NH2
<p>Peptide 5Fam-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-QALPETGEE-OH
<p>Peptide Fluor-QALPETGEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FTLSVDR-OH
<p>Peptide H-FTLSVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C37H60N10O12Molecular weight:836.93 g/molAc-GHG-NH2
<p>Peptide Ac-GHG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF-OH
<p>Peptide LCBiot-LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 17
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,661.8 g/molH-LLIYWASTR^-OH
<p>Peptide H-LLIYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-FSFKGIKFSKGKYK-NH2
<p>Peptide Ac-FSFKGIKFSKGKYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGHVQRQRREMVAQQHRC-OH
<p>H-TGHVQRQRREMVAQQHRC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TGHVQRQRREMVAQQHRC-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TGHVQRQRREMVAQQHRC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TGHVQRQRREMVAQQHRC-OH at the technical inquiry form on this page</p>Purity:Min. 95%CMVpp65 - 72 (GKISHIMLDVAFTSH)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,655.9 g/molH-GSQITQQSTNQSR^-OH
<p>Peptide H-GSQITQQSTNQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QGLPRAAGGC-NH2
<p>Ac-QGLPRAAGGC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-QGLPRAAGGC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-QGLPRAAGGC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-QGLPRAAGGC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%H-LLLASPR^-OH
<p>Peptide H-LLLASPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IL^GG-NH2
<p>Peptide H-IL^GG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 176
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,658.9 g/molH-QDGNEEMGGITQTPY-NTPEGBiot
<p>Peptide H-QDGNEEMGGITQTPY-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELYETASELPR^-OH
<p>Peptide H-ELYETASELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGDIVEFVCK^-OH
<p>Peptide H-TGDIVEFVCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-PICTF-OH
<p>Peptide Biot-PICTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GILLPQK^-OH
<p>Peptide H-GILLPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-RGPGRAFVTIGKIGNMR-NH2
<p>Peptide LCBiot-RGPGRAFVTIGKIGNMR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIFPLAER^-OH
<p>Peptide H-GIFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLVQQEGQLEQQER^-OH
<p>Peptide H-HLVQQEGQLEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VLQWAKKGYYTMKSN-NH2
<p>Peptide Ac-VLQWAKKGYYTMKSN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPKPQQFFGLM-NH2
<p>Peptide H-RPKPQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-VYPDHA-OH
<p>Peptide LCBiot-VYPDHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>cAMP Dependent PK Inhibitor (5-24), amide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C94H149N33O30Molecular weight:2,221.4 g/molH-TPVITGAPYEYR^-OH
<p>Peptide H-TPVITGAPYEYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KRHR-NH2
<p>Peptide Ac-KRHR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 4
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,824.4 g/molSIVmac239 envelope - 87
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:2,317.9 g/molH-DFEIISDTK^-OH
<p>Peptide H-DFEIISDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YAAELHLVHWNTK^-OH
<p>Peptide H-YAAELHLVHWNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-V^YIHPF-OH
<p>Peptide H-V^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLVPMVATV-NH2
<p>Peptide H-NLVPMVATV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTVEDPVTVEYITR^-OH
<p>Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGGVWAAK^-OH
<p>Peptide H-GPGGVWAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATFQTPDFIVPLTDLR^-OH
<p>Peptide H-ATFQTPDFIVPLTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Influenza HA (518-526)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C42H69N9O15Molecular weight:940.07 g/molH-L^GGDL^GTYVINK^-OH
<p>Peptide H-L^GGDL^GTYVINK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pal-KTTKS-OH
<p>Peptide Pal-KTTKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYTITGLQPGTDYK^-OH
<p>Peptide H-SYTITGLQPGTDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STELLIR^-OH
<p>Peptide H-STELLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-PQAQQKSLLQQLLTE-OH
<p>Peptide LCBiot-PQAQQKSLLQQLLTE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYTDASFTNR^-OH
<p>Peptide H-EYTDASFTNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVQEVTDFAK^-OH
<p>Peptide H-LVQEVTDFAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSVFPL^APSSK-OH
<p>Peptide H-GPSVFPL^APSSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIGLPEELIQK^-OH
<p>Peptide H-AIGLPEELIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLDDLK^^-OH
<p>Peptide H-HLDDLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVQLVQSGAEVK^-OH
<p>Peptide H-EVQLVQSGAEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Magainin 2
<p>Peptide Magainin 2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C114H180N30O29SMolecular weight:2,466.95 g/molH-SGYSGIFSVEGK^-OH
Peptide H-SGYSGIFSVEGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTPQAFSHFTFER^-OH
<p>Peptide H-LTPQAFSHFTFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLCGLLAER^-OH
<p>Peptide H-LLCGLLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KPNFIRF-NH2
<p>Peptide H-KPNFIRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VELAPLPSWQPVGK^-OH
<p>Peptide H-VELAPLPSWQPVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-IEEQAKTFLDKFNHEAEDLFYQS-NH2
<p>Peptide LCBiot-IEEQAKTFLDKFNHEAEDLFYQS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGMEVTPSGTWLTYTGAIK^-OH
<p>Peptide H-IGMEVTPSGTWLTYTGAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IYVDDGLISLQVK^-OH
<p>Peptide H-IYVDDGLISLQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVPCEPPEV^-OH
<p>Peptide H-VVPCEPPEV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Metolachlor esa
CAS:<p>Metolachlor esa is a medicinal analog that has shown potential as an anticancer agent. It works by inhibiting kinases, which are enzymes involved in cell signaling pathways that regulate cell growth and division. Metolachlor esa has been found to induce apoptosis (programmed cell death) in cancer cells, making it a promising candidate for the treatment of tumors. In addition, this inhibitor has been detected in urine samples from both human and Chinese populations, suggesting that it may have clinical relevance. Overall, Metolachlor esa represents a promising new class of protein kinase inhibitors with potential for the development of novel cancer therapeutics.</p>Formula:C15H23NO5SPurity:Min. 95%Molecular weight:329.4 g/molAc-TKRWGFRSGVPPKVVC-NH2
<p>Peptide Ac-TKRWGFRSGVPPKVVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HEIPVLP^NR-OH
<p>Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-ADEYLIPQQ-OH
<p>Peptide LCBiot-ADEYLIPQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDYHPRDHTATWGGG-NH2
<p>Peptide H-RDYHPRDHTATWGGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELNEALELK^-OH
<p>Peptide H-ELNEALELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Gln53)-Connexin 37 (51-58) (human, mouse, rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C40H59N11O15Molecular weight:933.97 g/molH-LLIYY^TSR^-OH
<p>Peptide H-LLIYY^TSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CAT-NH2
<p>Peptide Ac-CAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin I (1-9)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C56H78N16O13Molecular weight:1,183.35 g/molH-SLSAPGNLLTK^-OH
<p>Peptide H-SLSAPGNLLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFL^-OH
Peptide H-YGGFL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVDALGNAIDGK^-OH
<p>Peptide H-VVDALGNAIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSTSPIVK^-OH
<p>Peptide H-TSTSPIVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVINEAWFPEDQR^-OH
<p>Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-NLRKSGTLGHPGSL-OH
<p>Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Gln²²,Asn²³)-Amyloid β-Protein (1-40)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C194H297N55O56SMolecular weight:4,327.9 g/molAc-CLSHPYLYAQLDGPR-NH2
<p>Peptide Ac-CLSHPYLYAQLDGPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-TFG-OH
<p>Peptide Ac-TFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Secretoneurin (rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C159H252N40O58Molecular weight:3,651.98 g/molH-KSAPATGGVKKPHR^-OH
<p>Peptide H-KSAPATGGVKKPHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hemopexin [069-079]
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>LCBiot-HAIYPRH-OH
<p>Peptide LCBiot-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQPTTPSEPTAIK^-OH
<p>Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEPEA-OH
<p>Peptide H-SEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Color and Shape:PowderAc-VPAPRYTVELAC-NH2
<p>Peptide Ac-VPAPRYTVELAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVPQTPL^HTSR-OH
<p>Peptide H-CVPQTPL^HTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SNRP70
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-LTYTAEVSVPK^-OH
<p>Peptide H-LTYTAEVSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Rpy-NH2
<p>Peptide Ac-Rpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-A^^^PG-OH
<p>Peptide H-A^^^PG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pazopanib - Bio-X ™
CAS:<p>Pazopanib is an antineoplastic agent that is used to treat advanced renal cell cancer and advanced soft tissues sarcoma. This drug is a multitargeted tyrosine kinase inhibitor against vascular endothelial growth factor receptor 1, 2, 3 and c-kit. As a result, it increases tumor apoptosis and decreases tumor blood flow.</p>Formula:C21H23N7O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:437.52 g/molAc-RGDY-NH2
<p>Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLQESNVLYQHNLR^-OH
<p>Peptide H-FLQESNVLYQHNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFGVTTLDIVR^-OH
<p>Peptide H-IFGVTTLDIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WAAVVVPSGEEQR^-OH
Peptide H-WAAVVVPSGEEQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTGISDPVTVK^-OH
<p>Peptide H-LTGISDPVTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-V^IFDANAPV^AV^R^-OH
<p>Peptide H-V^IFDANAPV^AV^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTIAALLSPYSYSTTAVVTNPK^E-OH
<p>Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGAVAEEVLAAIR^-OH
<p>Peptide H-AGAVAEEVLAAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-83/aa329 - 343
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,514.9 g/molTyrosinase (206-214) (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C61H83N15O10Molecular weight:1,186.44 g/molH-IQTIILK^-OH
<p>Peptide H-IQTIILK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQQCP^FEDHVK-OH
<p>Peptide H-LQQCP^FEDHVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGFPWSEIR^-OH
<p>Peptide H-IGFPWSEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DMQLGR^-OH
<p>Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-STHTLDLSR-OH
<p>Peptide LCBiot-STHTLDLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GYSIFSYATK^-OH
<p>Peptide H-GYSIFSYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLLGLCEQK^-OH
<p>Peptide H-DLLGLCEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CQDERLPHYLRDED-NH2
<p>Peptide Ac-CQDERLPHYLRDED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IESPGYLTSPGYPHSYHPSEK^-OH
<p>Peptide H-IESPGYLTSPGYPHSYHPSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YQGFIFDIVTK^-OH
<p>Peptide H-YQGFIFDIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CLKYFGKALENPTR-NH2
<p>Peptide Ac-CLKYFGKALENPTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Des-octanoyl)-Ghrelin (mouse, rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C139H231N45O41Molecular weight:3,188.67 g/molBBC3-related peptide amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-HSSYWYAFNNKT-NH2
<p>Peptide H-HSSYWYAFNNKT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-WDWDWDWDWDWDWDWDWDWD-NH2
<p>Peptide Ac-WDWDWDWDWDWDWDWDWDWD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNQLESK^-OH
<p>Peptide H-LNQLESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Blocking peptide for Neurogranin pAb (Prod. No. BML-NA1300)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,828.1 g/molH-L^GP^L^VEQGR^-OH
<p>Peptide H-L^GP^L^VEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Funalenone
CAS:<p>Funalenone is a polyketide-based secondary metabolite, which is synthesized by various fungal species, particularly those belonging to the genus Penicillium. Its origin lies in the diverse biosynthetic pathways of filamentous fungi that produce an array of bioactive compounds. Funalenone operates through intricate biochemical interactions, potentially leveraging its electrophilic centers to react with nucleophilic biomolecules, thereby modifying biological pathways.</p>Formula:C15H12O6Purity:Min. 95%Molecular weight:288.25 g/molH-R^DSSWSETSEASYSGL-OH
<p>Peptide H-R^DSSWSETSEASYSGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVPLNTIIFMGR^-OH
<p>Peptide H-EVPLNTIIFMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KLTWQELYQLKYKGI-NH2
<p>Peptide Ac-KLTWQELYQLKYKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HVPGGGSVQIVYKPVDLSK^-OH
<p>Peptide H-HVPGGGSVQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CONSENSUS B Tat - 22
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,804 g/molH-QTLWPILAL-OH
<p>H-QTLWPILAL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QTLWPILAL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QTLWPILAL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QTLWPILAL-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-YMLDL^QPET-OH
<p>Peptide H-YMLDL^QPET-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSESGIFTNTK^-OH
<p>Peptide H-GSESGIFTNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amiodarone HCl - Bio-X ™
CAS:<p>Amiodarone, a class III anti-arrhythmic agent is used to treat and prevent certain types of irregular heartbeats. It is a competitor for natural ligands of alpha and beta adrenergic receptors, muscarinic acetylcholine receptors, histamine H1 receptors, and serotonin 5HT2A/5HT2C receptors. Amiodarone has been shown to reduce the number of atrial and ventricular arrhythmias in patients with structural heart disease, and has been used to treat atrial fibrillation, ventricular tachycardia, and Wolff-Parkinson-White Syndrome. It has also been used in the prevention of myocardial infarcts due to its ability to modify blood pressure and maintain cardiac function. In addition, amiodarone inhibits prostaglandin synthesis by inhibiting cyclooxygenase enzymes. This prevents inflammation in the gastrointestinal tract and reduces bowel disease symptoms such as cramping or diarrhoea.<br>Amiodarone HCl is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>Formula:C25H29I2NO3•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:681.77 g/molTucatinib
CAS:<p>Tucatinib is a small molecule, tyrosine kinase inhibitor, which is a synthetic, targeted therapeutic agent with a specific mode of action. It specifically inhibits the kinase activity of the human epidermal growth factor receptor 2 (HER2), a member of the epidermal growth factor receptor (EGFR) family. HER2 is overexpressed in a significant subset of breast cancers, leading to aggressive tumor characteristics and poor prognosis.</p>Formula:C26H24N8O2Purity:Min. 95%Molecular weight:480.52 g/molAc-MRTPRCGVPDLGR-NH2
<p>Peptide Ac-MRTPRCGVPDLGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Palonosetron HCl - Bio-X ™
CAS:<p>Palonosetron is a selective serotonin 5-HT3 receptor antagonist. It is an antinauseant and antiemetic agent that has been shown to be effective in preventing nausea and vomiting induced by cancer chemotherapy, radiotherapy, or surgery. By directly inhibiting serotonin activity in the region postrema and the chemoreceptor trigger zone, the inhibition of 5-HT3 receptors also prevents the visceral afferent stimulation of the vomiting center.</p>Formula:C19H24N2O·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:332.87 g/molH-TPPT-NH2
<p>Peptide H-TPPT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GKEESLDSDLYAELR^-OH
Peptide H-GKEESLDSDLYAELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MSSYAFFVQTCR^-OH
<p>Peptide H-MSSYAFFVQTCR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DILR^-OH
<p>Peptide H-DILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLSSTVFK^-OH
<p>Peptide H-QLSSTVFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Thr-Val-Val
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C14H27N3O5Molecular weight:317.38 g/molH-LQLQP^FPQPQLPY-OH
<p>Peptide H-LQLQP^FPQPQLPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-37/aa145 - 159
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,682 g/molH-WESGYNTR^-OH
<p>Peptide H-WESGYNTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CRNLTRKTESALAKD-OH
<p>Peptide Ac-CRNLTRKTESALAKD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GWIFGTTLDSK^-OH
<p>Peptide H-GWIFGTTLDSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Carcinoembryonic antigen-related cell adhesion molecule 5 (653-667)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Mastoparan X
<p>Peptide Mastoparan X is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C73H126N20O15SMolecular weight:1,556.01 g/molH-EGGVTFTWVEK^-OH
<p>Peptide H-EGGVTFTWVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FTVLSIVNRVRKGYS-OH
<p>H-FTVLSIVNRVRKGYS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FTVLSIVNRVRKGYS-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FTVLSIVNRVRKGYS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FTVLSIVNRVRKGYS-OH at the technical inquiry form on this page</p>Purity:Min. 95%Glycogen Synthase - derived peptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C49H92N16O14Molecular weight:1,129.38 g/molH-VVGACGVGK^-OH
<p>Peptide H-VVGACGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFFADYEIPNLQK^-OH
<p>Peptide H-GFFADYEIPNLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WTLTAPPGYR^-OH
<p>Peptide H-WTLTAPPGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Sudocetaxel zendusortide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C179H248N28O57Molecular weight:3,704.03 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-vip (1-7)-grf (8-27)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C150H246N44O38Molecular weight:3,273.88 g/molAc-IRIKIRIK-NH2
<p>Peptide Ac-IRIKIRIK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STQAAIDQINGK^-OH
<p>Peptide H-STQAAIDQINGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CITTAYYR-NH2
<p>Ac-CITTAYYR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CITTAYYR-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CITTAYYR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CITTAYYR-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Ac-CETVSTQELYS-NH2 PAB-403-404C6
<p>Peptide Ac-CETVSTQELYS-NH2 PAB-403-404C6 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSSASDYNSSELK^-OH
<p>Peptide H-VSSASDYNSSELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVQYLNEIK^-OH
<p>Peptide H-GVQYLNEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HYFIAAVER^-OH
<p>Peptide H-HYFIAAVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AKRHRKVLRD-NH2
<p>Peptide Ac-AKRHRKVLRD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANALLANGVELR^-OH
Peptide H-ANALLANGVELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-ASHEEVEGLVEK-OH
<p>Peptide LCBiot-ASHEEVEGLVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
<p>Peptide LCBiot-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QITIPSQEQEHSQK^-OH
<p>Peptide H-QITIPSQEQEHSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGDLYEEEMR^-OH
<p>Peptide H-LGDLYEEEMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIIVFNLL^-OH
<p>Peptide H-SIIVFNLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NRRRRWRERQR-NH2
<p>Peptide Ac-NRRRRWRERQR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSLDLDQYPLGR^-OH
<p>Peptide H-FSLDLDQYPLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNTSESF-NH2
<p>Peptide H-SNTSESF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYDLDPGAGSLEI^-OH
<p>Peptide H-SYDLDPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLDPER^-OH
<p>Peptide H-TLDPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIADIFEYTAK^-OH
<p>Peptide H-IIADIFEYTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGKPAPDFK^-OH
<p>Peptide H-IGKPAPDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPHYSLPGSSTL-NH2
<p>Peptide H-YPHYSLPGSSTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclin A1 227-235 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>ASP-5286
<p>ASP-5286 is a research tool that can be used to study ion channels and ligand-receptor interactions. It is a peptide that binds to the extracellular domain of the human calcitonin receptor, an ion channel protein. This inhibitor can also be used in the study of receptor-ligand interactions. ASP-5286 has been shown to activate certain ion channels, such as calcium channels and potassium channels. It also inhibits other ion channels such as sodium channels. ASP-5286 is a high purity material with a CAS number of 132091-26-8.</p>Formula:C60H107N11O13Purity:Min. 95%Molecular weight:1,190.56 g/molH-GSISIQTEEQIHGK^-OH
<p>Peptide H-GSISIQTEEQIHGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVDQNIFSFYLSR^-OH
<p>Peptide H-LVDQNIFSFYLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QFTSSTSYNR^-OH
<p>Peptide H-QFTSSTSYNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDNLAR^-OH
<p>Peptide H-ALDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-AAGIGILTV-OH
<p>Peptide Fmoc-AAGIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTPPVL^DSDGSF^FLYSR-OH
<p>Peptide H-TTPPVL^DSDGSF^FLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQDNEILIFWSK^-OH
<p>Peptide H-RQDNEILIFWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Clebopride maleate - Bio-X ™
CAS:<p>Clebopride is a dopamine antagonist drug that is used in the treatment of symptoms associated with gastrointestinal disorders. This drug is also used to treat nausea and vomiting. Clebopride blocks dopamine to allow an increase in the release of acetylcholine so that muscle movement in the digestive system is increased.</p>Formula:C20H24ClN3O2•(C4HO4)xPurity:Min. 95%Color and Shape:PowderMolecular weight:489.9 g/molBiot-KKSRGDYMTMQIG-NH2
<p>Peptide Biot-KKSRGDYMTMQIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-107
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,778 g/molAc-FHDDSDEDLLHI-NH2
<p>Peptide Ac-FHDDSDEDLLHI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 82 (QIFLEVQAIRETVEL)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,788.1 g/mol
