Biochemicals and Reagents

<p>Cjb 090 dihydrochloride hydrate is a potent inhibitor of Protein Kinase C (PKC), which plays a crucial role in cellular signaling pathways. Derived through chemical synthesis, Cjb 090 selectively targets and inhibits PKC activity, thereby disrupting signal transduction mechanisms involved in cell growth, differentiation, and apoptosis.</p>

<p>N-(3-(5-((3-Acrylamido-4-(morpholine-4-carbonyl)phenyl)amino)-1-methyl-6-oxo-1,6-dihydropyridin-3-yl)-2-methylphenyl)-4-(tert-butyl) benzamide is a novel pharmaceutical compound, which is synthesized through an intricate organic chemistry process aimed at targeting specific pathophysiological pathways. This compound functions by modulating cellular pathways with high specificity, potentially altering disease progression at the molecular level.</p>

<p>Rabbit polyclonal Ku80 antibody (Thr714)</p>

<p>The Cystatin B antibody is a highly specific and reliable tool for detecting and measuring Cystatin B levels in human serum samples. This polyclonal antibody has been extensively validated and shows excellent performance in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Goat anti-rabbit IgG (H+L) (Rhodamine) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>CEP-28122 is a potent antitumor agent that inhibits the growth of tumors by inhibiting the tyrosine kinase domain of the epidermal growth factor receptor (EGFR). CEP-28122 is activated by cyclin-dependent kinases to inhibit EGFR. It has been shown to be active in clinical studies for colorectal adenocarcinoma and other cancers. CEP-28122 has a high degree of selectivity for tumor cells, which are characterized by activation of the EGFR tyrosine kinase domain, and low toxicity for normal cells. The pharmacokinetic properties and molecular pathogenesis of this drug have been studied in detail.</p>

<p>Please enquire for more information about L-Cysteinyl-L-lysine trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal ARMX3 antibody</p>

<p>Rabbit polyclonal GPR103 antibody</p>

<p>TM2D2 antibody was raised in rabbit using the middle region of TM2D2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTRT2 antibody, catalog no. 70R-2384</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL1 antibody, catalog no. 70R-2538</p>

<p>The ICAM1 antibody is a highly specialized monoclonal antibody that targets the ICAM1 protein. It is also available as polyclonal antibodies. This antibody specifically binds to the ICAM1 protein, which is involved in various cellular processes such as hormone peptide signaling and glycan modification. By binding to the ICAM1 protein, this antibody can neutralize its activity and prevent it from interacting with other molecules in the body.</p>

<p>Rabbit polyclonal OSBPL10 antibody</p>

<p>Purified Rabbit polyclonal BAGE4 antibody</p>

<p>The ATF4 antibody is a highly potent and activated monoclonal antibody that is used in various immunoassays. It is specifically designed to target and bind to ATF4, a transcription factor involved in the regulation of gene expression. This antibody has been extensively tested and validated for use in particle reaction assays, making it an ideal choice for researchers in the Life Sciences field.</p>

<p>SETD2 antibody was raised in rabbit using the N terminal of SETD2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CST4 antibody, catalog no. 70R-1571</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2C antibody, catalog no. 70R-5588</p>

<p>TCR Alpha + TCR Beta Monoclonal Antibody</p>

<p>IRAK2 antibody was raised in rabbit using the C terminal of IRAK2 as the immunogen</p>

<p>CD122 antibody was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPIE antibody, catalog no. 70R-1434</p>

<p>The Claudin 4 antibody is a highly effective polyclonal antibody that specifically targets Claudin 4, an important protein involved in cell adhesion and tight junction formation. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Purified Polyclonal RRAD antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POU5F1 antibody, catalog no. 70R-8464</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of METAP2 antibody, catalog no. 70R-2897</p>

<p>Rabbit polyclonal PSMD11 antibody (HRP)</p>

<p>CD40 antibody was raised in Rabbit using Human CD40 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMED1 antibody, catalog no. 70R-7395</p>

<p>CRISP3 antibody was raised in Rabbit using Human CRISP3 as the immunogen</p>

<p>Purified recombinant Human PDRG1 protein</p>

<p>Rabbit polyclonal FKHR antibody (Ser256)</p>

<p>The CDC25C antibody is a polyclonal antibody that specifically targets the growth factor CDC25C. It is known to play a crucial role in cell cycle regulation and is primarily located on the apical membrane of cells. The CDC25C antibody can be used in various assays and experiments to detect and measure the levels of CDC25C protein. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The CDC25C antibody has been widely used in studies related to hepatocyte growth, epidermal growth, human folate metabolism, collagen activation, and glycosylation processes. Additionally, it has been employed as an inhibitor of phosphatase activity in different experimental settings. With its high specificity and reliability, the CDC25C antibody is an essential tool for researchers studying cell cycle regulation and related pathways.</p>

<p>RAB35 antibody was raised in rabbit using the middle region of RAB35 as the immunogen</p>

<p>Voriconazole is an antifungal agent that inhibits the synthesis of ergosterol, a component of fungal cell membranes. It binds to the cytochrome P450 enzyme, which is involved in the conversion of lanosterol to ergosterol. Voriconazole has been shown to have potent inhibitory effects on ion channels and protein interactions. It is also used as a research tool for studying protein-protein interactions and receptor pharmacology. This compound can be used as an activator or inhibitor depending on its target.</p>

<p>Please enquire for more information about 2-Aminofluorene-9-13C including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Propiconazole-d7 is an analog of the fungicide Propiconazole that has been deuterated at seven positions. It has been shown to have anticancer properties by inhibiting the activity of kinases, which are enzymes involved in cell signaling and proliferation. Propiconazole-d7 has been found to inhibit the activity of several kinases, including glycogen synthase kinase-3β (GSK-3β), cyclin-dependent kinase 2 (CDK2), and mitogen-activated protein kinase (MAPK). This inhibition leads to apoptosis or programmed cell death in cancer cells. Propiconazole-d7 has also been shown to inhibit the growth of human cancer cells, such as those derived from breast, lung, prostate, and liver tissues. In Chinese hamster ovary cells, it induces the accumulation of glycerol and indirubin, which are markers of apoptosis. Propiconazole-d7 may have potential as a therapeutic inhibitor for cancer treatment due to its

<p>Biphenyl-2-yl-4-(2-isopropylaminoacetamide) is a ligand that can bind to receptors and ion channels. It may also be used for research as a cell biology reagent, or as an antibody or inhibitor. The purity of this product is greater than 98% (HPLC).</p>

<p>Please enquire for more information about Dronedarone C including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin S Precursor-Related Peptide 37 (Mouse) is a peptide that activates the neuromedin S receptor. The receptor for neuromedin S precursor related peptide 37 is found in the central and peripheral nervous system, as well as in various other tissues. Neuromedin S precursor related peptide 37 is a ligand for the neuromedin S receptor and is an activator of ion channels. This molecule has been shown to inhibit protein interactions and has been used as a pharmacological agent in research to study protein interactions and ion channels.</p>

<p>Please enquire for more information about TentaGel® Macrobead RAM particle size: 140 - 170 µm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14ORF101 antibody, catalog no. 70R-8031</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM98A antibody, catalog no. 70R-4239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR75 antibody, catalog no. 70R-6305</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL1RL1 antibody, catalog no. 70R-7411</p>

<p>Purified recombinant Human TCP1 protein</p>

<p>Rabbit Polyclonal PKR antibody (Thr451)</p>

<p>The rpS6 antibody is a polyclonal antibody that specifically targets fibrinogen, a cation-binding protein found in human serum. It is commonly used in life sciences research to study the antigen-antibody reaction and molecular weight complexes. The rpS6 antibody has high affinity and specificity for its target and can be used in various applications such as immunoprecipitation, Western blotting, and immunofluorescence. It has been shown to have strong dna binding activity and can detect the presence of fibrinogen in platelet fibrinogen samples. Additionally, the rpS6 antibody can be used to study cation channels and their role in cellular processes. It is available as both polyclonal and monoclonal antibodies and can be used with different types of samples including nuclear extracts.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Apbb1 antibody, catalog no. 70R-9328</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>Rabbit polyclonal MIB1 antibody (FITC)</p>

<p>Rabbit polyclonal SERC3 antibody</p>

<p>Region of MIP2 protein corresponding to amino acids LGASWHRPDK CCLGYQKRPL PQVLLSSWYP TSQLCSKPGV IFLTKRGRQV CADKSKDWVK KLMQQLPVTA.</p>

<p>PHF6 antibody was raised in rabbit using the N terminal of PHF6 as the immunogen</p>

<p>Mouse monoclonal PAI1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNB1 antibody, catalog no. 70R-3118</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf30 antibody, catalog no. 70R-3881</p>

<p>GABRP antibody was raised in rabbit using the N terminal of GABRP as the immunogen</p>

Pig serum antibody was raised in rabbit using porcine serum as the immunogen.

<p>The TYK2 antibody is a highly effective tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, allowing for versatility in various applications. The TYK2 antibody specifically targets the TYK2 protein kinase, which plays a crucial role in cellular signaling pathways.</p>

Rabbit polyclonal PACSIN2 antibody

<p>SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHA12 antibody, catalog no. 70R-6159</p>

<p>FGFBP2 antibody was raised in Rabbit using Human FGFBP2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FGF14 antibody, catalog no. 70R-9286</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TUBB antibody, catalog no. 70R-6025</p>

<p>Human IgM protein (Fc5mu) (HRP) conjugate</p>

<p>Rabbit polyclonal DJ1 antibody</p>

<p>Rabbit polyclonal DUS2L antibody</p>

<p>NME4 antibody was raised using the middle region of NME4 corresponding to a region with amino acids VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV</p>

<p>The NTNG1 antibody is a monoclonal antibody that targets the NTNG1 protein. It plays a crucial role in various cellular processes such as fas-mediated apoptosis, collagen synthesis, and iron homeostasis. This antibody specifically binds to the NTNG1 protein, which is involved in cell growth and development. By binding to this target molecule, the NTNG1 antibody induces apoptosis in activated cells and inhibits their growth. Additionally, it has cytotoxic effects on cancer cells and has been used in research studies in the field of Life Sciences. The NTNG1 antibody can also be used for diagnostic purposes to detect autoantibodies or as a tool for studying iron metabolism and ferritin synthesis.</p>

<p>Rabbit polyclonal PPIC antibody</p>

<p>Rabbit polyclonal GABARAPL2 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A4 antibody, catalog no. 70R-6504</p>

<p>EIF4B antibody was raised in Rabbit using Human EIF4B as the immunogen</p>

<p>Goat anti-human IgG (H + L) (Fab'2) (rhodamine) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Region of CTACK protein corresponding to amino acids FLLPPSTACC TQLYRKPLSD KLLRKVIQVE LQEADGDCHL QAFVLHLAQR SICIHPQNPS LSQWFEHQER KLHGTLPKLN FGMLRKMG.</p>

<p>The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD7 antibody, catalog no. 70R-5085</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5E antibody, catalog no. 70R-9425</p>

<p>Rabbit polyclonal PITPNM1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NXF5 antibody, catalog no. 70R-8491</p>

<p>Desmoyokin antibody was raised in Guinea Pig using synthetic peptides of human desmoyokin coupled to KLH as the immunogen.</p>

<p>The MAEA antibody is a polyclonal antibody that targets the MAEA protein. This antibody has been widely used in various life sciences research applications, including hybridization studies, immunoassays, and Western blotting. The MAEA antibody has shown neutralizing activity against insulin and leukemia inhibitory factor (LIF), making it a valuable tool for studying the role of these factors in cell signaling pathways. Additionally, this antibody has been used in studies investigating the effects of fatty acids, hepatocyte growth factor (HGF), epidermal growth factor (EGF), and insulin on cellular processes. The MAEA antibody is available conjugated to different labels, such as biotin or streptavidin, allowing for easy detection and visualization in experimental setups. With its versatility and high specificity, the MAEA antibody is an essential tool for researchers in the field of life sciences.</p>

<p>Capping Protein beta 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine F-actin Beta 3 subunit capping protein coupled to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSDHL antibody, catalog no. 70R-1783</p>

<p>ANKRD1 antibody was raised in Rabbit using Human ANKRD1 as the immunogen</p>

<p>Meis3 antibody was raised in rabbit using the C terminal of Meis3 as the immunogen</p>

<p>Rabbit polyclonal HER2 antibody (Tyr1221/Tyr1222)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CAP1 antibody, catalog no. 70R-5729</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A1 antibody, catalog no. 70R-6796</p>

<p>Rabbit Polyclonal EGFR antibody (Tyr1172)</p>

<p>Affinity purified Rabbit polyclonal ABCD2 antibody</p>

<p>RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids  GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP</p>

<p>ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH3A1 antibody, catalog no. 70R-9873</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOR antibody, catalog no. 70R-1177</p>

<p>Goat anti-Guinea Pig IgG (H + L) was raised in goat using purified Guinea Pig IgG (H&amp;L) as the immunogen.</p>

<p>ANGPTL7 antibody was raised in rabbit using the middle region of ANGPTL7 as the immunogen</p>

<p>Purified recombinant Human LSM4 protein</p>

<p>Purified recombinant Human ARL1 protein</p>

<p>FLJ37543 antibody was raised using the N terminal of FLJ37543 corresponding to a region with amino acids MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA6 antibody, catalog no. 70R-3558</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MORF4L1 antibody, catalog no. 70R-1284</p>

<p>Rabbit polyclonal POLI antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBD antibody, catalog no. 70R-5744</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINI2 antibody, catalog no. 70R-9424</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM42 antibody, catalog no. 70R-4011

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B4 antibody, catalog no. 70R-4853</p>

<p>R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSTK antibody, catalog no. 70R-4183</p>

<p>Chicken Serum Albumin is a growth factor that belongs to the category of Native Proteins &amp; Antigens in the Life Sciences field. It is derived from chicken serum and has various applications in research and laboratory settings. Chicken Serum Albumin can be used for immobilization purposes, such as coating surfaces or electrodes, to enhance cell adhesion and promote endothelial growth. Additionally, it has been found to have interactions with histidine, creatine kinase, androgen, erythropoietin, dopamine, epidermal growth factor, monoclonal antibody, and the erythropoietin receptor. These interactions make Chicken Serum Albumin a versatile tool for studying protein-protein interactions and cellular signaling pathways. Its high purity and stability make it a reliable choice for researchers in need of a consistent and well-characterized protein source.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ISG20 antibody, catalog no. 70R-1340</p>

<p>The SOD2 antibody is a polyclonal antibody that specifically targets the superoxide dismutase 2 (SOD2) protein. This antibody is commonly used in life sciences research to study the role of SOD2 in various cellular processes.</p>

<p>Affinity purified Rabbit polyclonal FSD2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCAP antibody, catalog no. 70R-3625</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MIA2 antibody, catalog no. 70R-10165</p>

<p>Rabbit polyclonal CXCL5 antibody (FITC)</p>

<p>LONRF1 antibody was raised using the N terminal of LONRF1 corresponding to a region with amino acids MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPB antibody, catalog no. 70R-4699</p>

<p>Rabbit polyclonal MIC1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNPTAB antibody, catalog no. 70R-8832</p>

<p>ASB17 antibody was raised in Rabbit using Human ASB17 as the immunogen</p>

<p>The RBP1 antibody is a highly specialized polyclonal antibody that is used in various life sciences assays. It is specifically designed to target and bind to the RBP1 protein, which plays a crucial role in glucose transportation and dopamine regulation. This antibody is produced by immunizing animals with the specific antigen, resulting in the generation of high-affinity antibodies that can recognize and bind to the target protein.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCL16 antibody, catalog no. 70R-7847</p>

<p>Purified recombinant Human OVCA2 protein (His tag)</p>

<p>Leptin antibody was raised in mouse using highly pure recombinant human leptin as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF276 antibody, catalog no. 70R-8119</p>

<p>Rhebl1 antibody was raised in rabbit using the N terminal of Rhebl1 as the immunogen</p>

<p>The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.</p>

<p>Rabbit polyclonal Histone H2A.X antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FKBPL antibody, catalog no. 70R-3368</p>

<p>Rabbit polyclonal RAF1 antibody (Ser642)</p>

<p>MGC29891 antibody was raised in rabbit using the C terminal of MGC29891 as the immunogen</p>

<p>Rabbit polyclonal CEBPE antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4G3 antibody, catalog no. 70R-4940</p>

<p>Rabbit polyclonal OXER1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HRK antibody, catalog no. 70R-6345</p>

<p>Purified Polyclonal TM2D1 antibody</p>

<p>Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.</p>

<p>OAZ3 antibody was raised in rabbit using the middle region of OAZ3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5A antibody, catalog no. 70R-5861</p>

<p>CK1 gamma 2 antibody was raised using the N terminal of CSNK1G2 corresponding to a region with amino acids FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK</p>

<p>GCDH antibody was raised using the C terminal of GCDH corresponding to a region with amino acids IARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG</p>

<p>COLEC11 antibody was raised in Rabbit using Human COLEC11 as the immunogen</p>

<p>Rabbit polyclonal ERH antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DAZ3 antibody, catalog no. 70R-4845</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPPE1 antibody, catalog no. 70R-7157</p>

<p>ATRIP antibody was raised in Rabbit using Human ATRIP as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBMY1A1 antibody, catalog no. 70R-4807</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERCC4 antibody, catalog no. 70R-2117</p>

<p>Rabbit Polyclonal FAK antibody (Tyr576/Tyr577)</p>

<p>hCG_1982709 antibody was raised in rabbit using the N terminal of HCG_1982709 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EVI2B antibody, catalog no. 70R-1812</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XRCC3 antibody, catalog no. 70R-10280</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHAF1B antibody, catalog no. 70R-5510</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DNASE1L3 antibody, catalog no. 70R-10360</p>

<p>Region of gAcrp30 protein corresponding to amino acids PGAEGPRGFP GIQGRKGEPG EGAYVYRSAF SVGLETYVTI PNMPIRFTKI FYNQQNHYDG STGKFHCNIP GLYYFAYHIT VYMKDVKVSL FKKDKAMLFT YDQYQENNVD QASGSVLLHL EVGDQVWLQV YGEGERNGLY ADNDNDSTFT GFLLYHDTN.</p>

<p>RCAN2 antibody was raised in rabbit using the middle region of RCAN2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGDIG antibody, catalog no. 70R-6038</p>

<p>HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE</p>

<p>SNAPC1 antibody was raised in rabbit using the C terminal of SNAPC1 as the immunogen</p>

<p>Amylase antibody is a polyclonal antibody that specifically targets and binds to amylase, an enzyme responsible for the breakdown of starch into sugars. This antibody has been widely used in life sciences research to study the role of amylase in various biological processes.</p>

<p>Rabbit polyclonal MED23 antibody</p>

<p>DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY</p>

<p>ST6GALNAC5 antibody was raised using the middle region of ST6GALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV</p>

<p>Goat anti-cat IgG (HRP) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>The MYB antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the MYB protein, which plays a crucial role in various cellular processes. The MYB antibody has been extensively used in research to study the function and regulation of MYB in different contexts.</p>