Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,185 products)
- By Biological Target(99,150 products)
- By Pharmacological Effects(6,789 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,764 products)
- Secondary Metabolites(14,307 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CCB02
CAS:<p>CCB02 is a sequence that is a member of the family of centrosomal proteins. CCB02 has been shown to be sensitive to cancer cells and may serve as an anti-cancer drug candidate. CCB02 has also been shown to have functions in centrosome duplication, which are important for cell division. CCB02 binds to acid sequences from the nucleic acid sequences and emits light in the near-infrared range. It is also fluorescent and can bind to acceptor molecules such as rubisco, which are important for carbon fixation in photosynthesis.</p>Formula:C14H9N3OPurity:Min. 95%Molecular weight:235.24 g/molTWEAK Receptor protein
<p>Region of TWEAK protein corresponding to amino acids EQAPGTAPCS RGSSWSADLD KCMDCASCRA RPHSDFCLGC AAAPPAPFRL LWP.</p>Purity:Min. 95%JNJ 10181457
CAS:<p>JNJ 10181457 is a drug that modulates the immune system and may be used as an immunomodulator to treat inflammatory conditions. It has been shown to have a number of effects on the immune system, including modulation of the immune response, induction of antigen-specific T-cell responses, and activation of macrophages. JNJ 10181457 has also been shown to suppress tumor growth in animal models by inducing apoptosis and inhibiting angiogenesis. This drug may be useful for treating cancer or autoimmune diseases because it blocks inflammation, which is involved in the development of these conditions.</p>Formula:C20H30Cl2N2OPurity:Min. 95%Molecular weight:385.4 g/molWinstray L
CAS:<p>Winstray L is an analog and inhibitor of tumor protein kinases. It is a potent anticancer agent that has been shown to inhibit the growth of cancer cells in vitro and in vivo. Winstray L specifically targets Chinese hamster ovary (CHO) cell kinase, which is a key regulator of cell growth and division. This drug belongs to a class of compounds known as kinase inhibitors, which have been developed for the treatment of cancer. Winstray L has been shown to induce apoptosis in human cancer cells and may be useful for treating a variety of cancers. Additionally, this drug has been found in urine after administration, indicating its potential for use as a diagnostic tool to monitor treatment efficacy. Capsaicin, a compound found in chili peppers, has been shown to enhance the activity of Winstray L against cancer cells.</p>Formula:C21H28OPurity:Min. 95%Molecular weight:296.4 g/molAnti PACAP38, humanSerum
<p>Anti PACAP38, humanSerum is a research tool that can be used to study the role of PACAP in various biological processes. The antibody is generated against human PACAP38 and has been shown to inhibit the activity of this peptide. The antibody also binds to the receptor for this peptide, which is a G protein-coupled receptor. This antibody can be used as an inhibitor of PACAP and its receptor in various cell types.</p>Purity:Min. 95%1-[6,7-Dihydro-2-(phenoxymethyl)pyrazolo[1,5-a]pyrimidin-4(5H)-yl]ethanone
CAS:<p>1-[6,7-Dihydro-2-(phenoxymethyl)pyrazolo[1,5-a]pyrimidin-4(5H)-yl]ethanone is a potent inhibitor of protein kinases that play a crucial role in the regulation of cell growth and apoptosis. It has been shown to induce apoptosis in tumor cells, making it a promising candidate for cancer therapy. This compound is an analog of a Chinese medicinal herb and has been found to inhibit cyclin-dependent kinases (CDKs) and other human protein kinases involved in cancer development. In vitro studies have demonstrated its potent anticancer activity against various cancer cell lines, including breast, prostate, and lung cancers.</p>Formula:C15H17N3O2Purity:Min. 95%Molecular weight:271.31 g/molCRTC1 antibody
<p>CRTC1 antibody was raised in Mouse using a purified recombinant fragment of human CRTC1 expressed in E. coli as the immunogen.</p>FLJ30934 antibody
<p>FLJ30934 antibody was raised in rabbit using the middle region of FLJ30934 as the immunogen</p>Purity:Min. 95%(±)-MDL 105725
CAS:<p>(±)-MDL 105725 is a drug that has been shown to be an atypical antipsychotic. It binds to the serotonin 5-HT2A receptor, which regulates the release of neurotransmitters such as dopamine, epinephrine, and norepinephrine. It also binds to the 5HT1A receptor, which regulates the release of serotonin. The binding affinity for these receptors is high and selective. MDL 105725 has a short half-life in animals and humans and is metabolized by cytochrome P450 enzymes. Human pharmacokinetic studies have shown that it can be detected in urine up to 24 hours after administration.</p>Formula:C21H26FNO3Purity:Min. 95%Molecular weight:359.4 g/molPPP1R8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R8 antibody, catalog no. 70R-4732</p>Purity:Min. 95%IL6 antibody
<p>The IL6 antibody is a powerful cytotoxic agent that targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various diseases. This monoclonal antibody specifically binds to IL-6, neutralizing its activity and preventing its interaction with cell surface receptors. By blocking the IL-6 signaling pathway, this antibody inhibits the production of other inflammatory mediators such as tumor necrosis factor-alpha (TNF-α) and interferons.</p>Isometheptene maleate
CAS:Controlled Product<p>Isometheptene maleate is a potent inhibitor of cyclin-dependent kinases (CDKs), which are enzymes that regulate cell cycle progression and play a critical role in tumorigenesis. It has been shown to induce apoptosis in cancer cells and inhibit tumor growth in Chinese hamster ovary cells. Isometheptene maleate is an analog of protein kinase inhibitors, which have been used as anticancer agents. This drug has also been found to be effective against various types of tumors in human urine samples. Its ability to inhibit CDKs makes it a promising candidate for the development of new cancer therapies.</p>Formula:C13H23NO4Purity:Min. 95%Molecular weight:257.33 g/molILDR1 antibody
<p>ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV</p>Purity:Min. 95%DHRS9 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHRS9 antibody, catalog no. 70R-5476</p>Purity:Min. 95%Tetraspanin 8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN8 antibody, catalog no. 70R-7247</p>Purity:Min. 95%LRRC49 antibody
<p>LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS</p>MMSET-IN-1
CAS:<p>MMSET-IN-1 is a small molecule inhibitor specifically designed to target the histone methyltransferase activity of MMSET (also known as NSD2 or WHSC1). This compound originates from a synthetic chemical library explicitly developed for epigenetic research. The mode of action involves the selective inhibition of MMSET's enzymatic function, which is responsible for di- and tri-methylation of lysine 36 on histone H3 (H3K36me2/3).</p>Formula:C18H29N7O5Purity:Min. 95%Molecular weight:423.5 g/molABL1 antibody
<p>The ABL1 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It is designed to target and bind to the ABL1 protein, which plays a crucial role in cell signaling and regulation. This antibody has been extensively tested and characterized for its high affinity and specificity, ensuring accurate and reliable results in various immunoassays.</p>IL1 β antibody
<p>The IL1 beta antibody is a monoclonal antibody that specifically targets and binds to IL1 beta, an inflammatory cytokine involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It has been found to inhibit the activation of IL1 beta, leading to a reduction in inflammation and associated symptoms.</p>RANK
<p>RANK, also known as Receptor Activator of Nuclear Factor Kappa-B, is a glycoprotein involved in various biological processes. It plays a crucial role in regulating bone metabolism and immune function. RANK is expressed on the surface of osteoclasts, dendritic cells, and other immune cells.</p>PX-478
CAS:<p>PX-478 is a drug that inhibits the function of P-glycoprotein (P-gp), which is a protein that transports certain drugs out of cells. PX-478 has been shown to inhibit the proliferation of tumor cells in vitro in response to radiation. It also inhibits the HIF-1α pathway, which leads to apoptosis and prevents tumor growth. In vivo, PX-478 inhibited tumor growth and prolonged survival time in a squamous carcinoma model system. The drug binds to the DNA response element upstream of the polymerase chain gene, thereby inhibiting transcription and translation.</p>Formula:C13H20Cl4N2O3Purity:Min. 95%Molecular weight:394.12 g/molClaudin 18 antibody
<p>Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE</p>Purity:Min. 95%Chondroadherin Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHAD antibody, catalog no. 70R-5471</p>Purity:Min. 95%YKL-05-099
CAS:<p>YKL-05-099 is a small molecule that inhibits the activity of histone acetyltransferases and histone deacetylases. Histones are proteins involved in DNA packaging, which are important for the transcriptional regulation of genes. YKL-05-099 has been shown to inhibit leukemia cells by inhibiting the anabolic effect of all-trans retinoic acid. YKL-05-099 also modulates cellular localization, affecting the migration of hematopoietic cells to bone marrow and their proliferation. The molecule has been shown to have pharmacokinetic properties that allow it to be administered orally. It is currently being studied as a potential treatment for myelodysplastic syndrome, a condition caused by abnormal hematopoietic cells in bone marrow.</p>Formula:C32H34ClN7O3Purity:Min. 95%Molecular weight:600.11 g/molα-2-Macroglobulin Heavy Tryptic Peptide Standard (4nmol)
<p>An Alpha-2-Macroglobulin heavy tryptic peptide standard for protein identification and quantitation studies. Alpha-2-Macroglobulin is a broad spectrum protease inhibitor which also plays roles in cell migration and in the binding of growth factors and cytokines.</p>Purity:Min. 95%Pyr-Lys-Arg-Pro-Ser-Gln-Arg-Ser-Lys-Tyr-Leu
CAS:<p>Pyr-Lys-Arg-Pro-Ser-Gln-Arg-Ser-Lys-Tyr-Leu is a lysine based peptide. It is an activator of the GABA receptor, which mediates inhibitory neurotransmission in the central nervous system. Pyr-Lys-Arg Pro Ser Gln Arg Ser Lys Tyr Leu has been shown to bind to the alpha2/delta subunit of the GABA receptor and increase its affinity for GABA. This peptide has also been shown to be an inhibitor of glutamate receptors.</p>Formula:C60H100N20O17Purity:Min. 95%Molecular weight:1,373.6 g/molAngiotensin Light Tryptic Peptide Standard (4nmol)
<p>Angiotensin Light Tryptic Peptide Standard f use in protein identification and quantitation studies. Angiotensin is a peptide hormone that causes vasoconstriction and is responsible for an increase in blood pressure. Furthermore angiotensin stimulates aldosterone release.</p>Purity:Min. 95%LIMK1 antibody
<p>The LIMK1 antibody is a monoclonal antibody that specifically targets LIM kinase 1 (LIMK1). It has been widely used in research and life sciences to study the role of LIMK1 in various cellular processes. This antibody is highly specific and shows minimal cross-reactivity with other proteins.</p>Mouse Brain antibody
<p>Mouse brain antibody was raised in rabbit using brain tissue from C3H mice as the immunogen.</p>Purity:Min. 95%DMU2105
CAS:<p>DMU2105 is a novel photosensitizer, developed from synthetic organic compounds, which operates through the absorption of specific wavelengths of light to produce reactive oxygen species. These reactive species interact with cellular components, inducing cytotoxicity and aiding in selective destruction of target cells. This mode of action is particularly effective in photodynamic therapy (PDT) and medical imaging.</p>Formula:C18H13NOPurity:Min. 95%Molecular weight:259.3 g/molSHBG protein
<p>Sex Hormone-Binding Globulin (SHBG) is a glycoprotein that binds to sex hormones, primarily testosterone, dihydrotestosterone (DHT), and estradiol. This protein regulates the bioavailability of sex hormones in the bloodstream by controlling how much is free (active) versus bound (inactive). It plays a crucial role in hormone transport and regulation by carrying these hormones in the blood and influencing their activity in tissues. Higher SHBG levels result in less free testosterone and estrogen available for use, while lower SHBG levels increase the amount of free hormones, potentially amplifying their physiological effects. Clinically, elevated SHBG levels can lead to low free testosterone, causing symptoms such as fatigue, low libido, and muscle loss, whereas low SHBG levels are linked to conditions like insulin resistance, polycystic ovary syndrome (PCOS), obesity, and type 2 diabetes. Several factors influence SHBG levels, including estrogen, hyperthyroidism, liver disease, and pregnancy, which increase SHBG, while testosterone, insulin resistance, obesity, and hypothyroidism decrease it. SHBG is commonly measured in hormone panels to assess hormonal balance in both men and women.</p>Purity:Min. 95%Tylosin A
CAS:<p>Tylosin A is a natural macrolide antibiotic that has been used in veterinary medicine for the treatment of respiratory and enteric infections. Recent studies have shown that tylosin A may also have potential as an anti-cancer agent. In vitro studies have demonstrated that tylosin A and its analogs induce apoptosis in human cancer cells, including those from lung, breast, and colon cancers. Tylosin A has also been shown to be a potent inhibitor of kinase activity, which plays a critical role in tumor growth and progression. Additionally, tylosin A has been found in Chinese traditional medicine as an active ingredient in menthol urine inhibitors.</p>Formula:C46H77NO17Purity:Min. 95%Molecular weight:916.1 g/mol3-Phenylquinoxalin-6-amine
CAS:<p>3-Phenylquinoxalin-6-amine is a drug that has been shown to be active against solid tumours in animal models and human cancer cells in vitro. It inhibits the synthesis of proteins, which is necessary for the development of cancer cells. 3-Phenylquinoxalin-6-amine was more effective than other drugs in reducing the activity index and blood sampling parameters of patients with chronic pulmonary infections. 3-Phenylquinoxalin-6-amine has also been shown to inhibit the production of cytokines, such as IL1β, TNFα, and IFNγ, by suppressing the production of transcriptional factors such as NFκB and AP1.</p>Formula:C14H11N3Purity:Min. 95%Molecular weight:221.26 g/molABCC8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCC8 antibody, catalog no. 70R-6686</p>Purity:Min. 95%UGT2B15 antibody
<p>UGT2B15 antibody was raised using the N terminal of UGT2B15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY</p>Purity:Min. 95%EN460
CAS:<p>Please enquire for more information about EN460 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H12ClF3N2O4Purity:Min. 95%Molecular weight:460.79 g/molPracinostat-d7
CAS:<p>Please enquire for more information about Pracinostat-d7 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O2Purity:Min. 95%Molecular weight:365.5 g/molTXNDC5 antibody
<p>The TXNDC5 antibody is a highly specific antibody that targets the antigen transthyretin. It is available in both polyclonal and monoclonal forms. This antibody is widely used in Life Sciences research for various applications, including the detection and quantification of transthyretin levels in biological samples. The TXNDC5 antibody has been shown to be activated by interleukin-6 and natriuretic peptides, making it an important tool for studying their signaling pathways. Additionally, this antibody has been used to investigate the role of TXNDC5 in antiestrogen resistance and nuclear processes. With its high specificity and sensitivity, the TXNDC5 antibody is a valuable tool for researchers working with nuclear extracts and studying the viscosity of biological samples. Choose this antibody for reliable results and accurate analysis in your experiments.</p>17-Aminogeldanamycin
CAS:<p>Inhibits chaperone protein Hsp90; antineoplastic</p>Formula:C28H39N3O8Purity:Min. 95%Color and Shape:PowderMolecular weight:545.62 g/molAvosentan
CAS:<p>Avosentan is an endothelin receptor antagonist that has been shown to be a long-term effective treatment for chronic kidney disease in diabetic patients. It blocks the binding of endothelin-A to its receptor, which prevents the constriction and dilation of blood vessels. Avosentan has been shown to increase renal function by inhibiting tubulointerstitial injury and reducing the rate of progression of chronic kidney disease. This drug also has a positive effect on congestive heart failure, as it increases cardiac output and reduces afterload. Avosentan also stimulates growth factor production in heart tissue, which may account for some of its positive effects on cardiac function.</p>Formula:C23H21N5O5SPurity:Min. 95%Molecular weight:479.51 g/molPesampator
CAS:<p>Pesampator is a peptide that binds to nicotinic acetylcholine receptors and activates these receptors. It has been shown to have a high degree of purity, with no detectable levels of impurities. Pesampator is used as a research tool in cell biology and pharmacology to study the interactions between proteins and peptides, as well as receptor activation by ligands. It also has applications in the treatment of diseases such as Alzheimer's disease, Parkinson's disease, depression, schizophrenia, and anxiety disorders.</p>Formula:C18H20N2O4S2Purity:Min. 95%Molecular weight:392.5 g/molTMCC2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC2 antibody, catalog no. 70R-7035</p>Purity:Min. 95%MG-115
CAS:<p>MG-115 is a proteasome inhibitor that blocks the degradation of proteins by inhibiting the activity of the 20S and 26S proteasomes. MG-115 has been shown to inhibit transfection experiments in neuronal death, and to induce apoptosis in carcinoma cell lines. It also inhibits proteolytic enzymes, oxidative injury, and antimicrobial agents by blocking the ubiquitin ligases that target these proteins for degradation. MG-115 also inhibits mitochondrial membrane potential (MMP) and induces Mcl-1 protein expression.</p>Formula:C25H39N3O5Purity:Min. 95%Molecular weight:461.59 g/molSCH 50911
CAS:<p>SCH 50911 is a potent antagonist of the 5-HT7 receptor, which is a G protein-coupled receptor. It has been shown to inhibit acetylcholine release in rat striatal tissue and to increase gamma-aminobutyric acid (GABA) levels in vitro. SCH 50911 also inhibits dopamine release in vitro and decreases locomotor activity in rats. These effects are thought to be due to the inhibition of acetylcholine release and decreased dopamine release. SCH 50911 has been clinically studied for its efficacy as a treatment for anxiety disorders and depression, but has not been approved for general use yet.</p>Formula:C8H15NO3Purity:Min. 95%Molecular weight:173.21 g/molPRL antibody
<p>The PRL antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to prolactin (PRL), a hormone involved in various physiological processes such as lactation, reproduction, and metabolism. This antibody is widely used in studies related to steroid hormones, dopamine, globulin, and progesterone. It can be utilized for applications such as immunohistochemistry, Western blotting, ELISA assays, and flow cytometry.</p>Vorasidenib
CAS:<p>Vorasidenib is a drug that has been approved for the treatment of adults with newly diagnosed glioblastoma. It is currently being investigated in preoperative settings, to see if it can reduce or eliminate the need for radiation therapy. Vorasidenib is an anti-angiogenic drug that blocks both vascular endothelial growth factor and platelet-derived growth factor receptors, which are key components of tumor angiogenesis. The drug has been shown to prolong survival in patients with malignant brain tumors and has few serious side effects. A multicenter phase II study showed a response rate of about 20% in patients with newly diagnosed gliomas who were given vorasidenib. Pharmacokinetic studies have demonstrated that vorasidenib crosses the blood-brain barrier and penetrates into the tumor cells at levels higher than other drugs used to treat gliomas.</p>Formula:C14H13ClF6N6Purity:Min. 95%Molecular weight:414.74 g/molSCH00013
CAS:<p>SCH00013 is a drug that has been used in clinical trials to treat cardiac and muscle diseases. It is an analog of the calcium channel blocker amlodipine, but with a longer half-life. SCH00013 has been shown to have an effect on ventricular myocytes in rats by reducing the incidence of ventricular arrhythmias and decreasing the severity of congestive heart failure. This drug also decreases diastolic blood pressure and prevents the onset of metabolic disorders such as diabetes mellitus type 2. SCH00013 may be useful in treating inflammatory bowel disease (IBD) because it can reduce intestinal inflammation by binding to TNF-α receptors, which reduces the symptoms of IBD.</p>Formula:C18H20N4O2Purity:Min. 95%Molecular weight:324.38 g/mol23:2 Diyne pe [dc(8,9)pe]
CAS:<p>23:2 Diyne pe (23:2 DPE) is a fluorescent and biocompatible molecule that can be used as a diagnostic tool for cancer. It is composed of two quinoline derivatives, which are linked together with a dicarboxylic acid. The hydrogen atoms on the two rings of the quinoline derivatives are replaced by deuterium atoms, which gives it high resistance to light exposure and particle bombardment. 23:2 DPE has been shown to bind to collagen, which is the main component of connective tissue in animals and humans. This binding allows 23:2 DPE to be used as a biomimetic molecule for diagnosing cancer, because it will only bind to cancer cells and not healthy cells. The molecular weight of 23:2 DPE is 994 g/mol and its chemical formula is C24H28N8O4.</p>Formula:C51H86NO8PPurity:Min. 95%Molecular weight:872.2 g/molSRT3025 Hydrochloride
CAS:<p>SRT3025 Hydrochloride is a synthetic small molecule, which is developed as an activator of the SIRT1 enzyme. SRT3025 is derived from chemical synthesis, designed specifically to modulate enzymatic activity associated with aging and metabolic regulation. The compound functions by enhancing the deacetylase activity of the SIRT1 enzyme, a member of the sirtuin family, which plays a crucial role in cellular processes related to longevity and metabolic regulation.</p>Formula:C31H31N5O2S2·HClPurity:Min. 95%Molecular weight:606.2 g/mol2-Isopropyl-5(methylphen-ethylamino)-2-phenylvaleronitrile hydrochloride
CAS:<p>2-Isopropyl-5(methylphen-ethylamino)-2-phenylvaleronitrile hydrochloride is a peptide that acts as an inhibitor of the enzyme protein interactions. It binds to the activator and ligand sites of ion channels, and blocks the flow of ions across cell membranes. 2-Isopropyl-5(methylphen-ethylamino)-2-phenylvaleronitrile hydrochloride has been used as a research tool for the study of ion channels. It has also been used in the production of antibodies against ion channels.</p>Formula:C23H30N2Purity:Min. 95%Molecular weight:334.5 g/molPIK-108
CAS:<p>PIK-108 is a peptide used as a research tool to study protein interactions, receptor function, and ligand binding. It interacts with ion channels and inhibits protein interactions. PIK-108 is a potent inhibitor of the human peptidyl prolyl cis/trans isomerase (PPIase) family, which includes PPIases from bacteria, plants, and humans. This inhibition prevents the enzymatic conversion of proline residues in proteins to their cis or trans forms. As a result, PIK-108 can be used to determine the importance of this enzyme for various cellular functions by testing the effect on cell growth.<br>PIC-108 has been shown to inhibit various members of the human PPIase family at low micromolar concentrations. The IC50 values for several bacterial enzymes are significantly higher than those for mammalian enzymes. The potency of PIK-108 against bacterial enzymes may be due to its high lipophilicity and increased ability to penetrate hydroph</p>Formula:C22H24N2O3Purity:Min. 95%Molecular weight:364.4 g/molAGL-2263
CAS:<p>AGL-2263 is a monocarboxylic acid that has been shown to have time-dependent and site-specific effects on glycogen metabolism. This drug inhibits the activity of glycogen synthase and glycogen synthase kinase, which are enzymes that catalyze the formation of glycogen from glucose. AGL-2263 also inhibits 3T3-L1 cells proliferation in culture, which may be due to its ability to induce receptor β downregulation. The mechanism of this drug's effect on cellular proliferation is not yet known.</p>Formula:C17H10N2O5Purity:Min. 95%Molecular weight:322.27 g/molAZ-33
CAS:<p>AZ-33 is a synthetically optimized biochemical compound, which is derived from naturally occurring plant alkaloids. With a robust mode of action, AZ-33 functions by selectively inhibiting specific enzymatic reactions, allowing precise modulation of metabolic pathways. This selectivity is achieved through its affinity for enzyme binding sites, where it interferes with substrate interactions.<br><br>The compound is used primarily in the field of biochemical research, where it serves as a critical tool in the exploration of metabolic processes and enzymatic functions. By providing insights into enzyme-related pathways, AZ-33 supports the development of potential therapeutic strategies and enhances the understanding of complex biochemical phenomena. Its applications extend to various domains, including pharmacology, molecular biology, and systems biology, making it an invaluable asset for exploratory research and experimental investigations in these fields.</p>Formula:C25H27N3O6SPurity:Min. 95%Molecular weight:497.56 g/moleIF4E antibody
<p>The eIF4E antibody is a highly specialized monoclonal antibody that targets the eukaryotic translation initiation factor 4E (eIF4E). This protein plays a crucial role in the regulation of gene expression and protein synthesis. The eIF4E antibody has been extensively studied for its ability to inhibit the activity of eIF4E, thereby disrupting the translation of specific mRNA molecules.</p>Purity:Min. 95%RAC2 protein (His tag)
<p>1-189 amino acids: MGSSHHHHHH SSGLVPRGSH MQAIKCVVVG DGAVGKTCLL ISYTTNAFPG EYIPTVFDNY SANVMVDSKP VNLGLWDTAG QEDYDRLRPL SYPQTDVFLI CFSLVSPASY ENVRAKWFPE VRHHCPSTPI ILVGTKLDLR DDKDTIEKLK EKKLAPITYP QGLALAKEID SVKYLECSAL TQRGLKTVFD EAIRAVLCPQ PTRQQKRAC</p>Purity:Min. 95%PBP 10
CAS:<p>PBP 10 is an antimicrobial agent that inhibits the growth of bacteria and fungi by binding to actin filaments. It has been shown to inhibit the production of fatty acid and lipid peroxide in rat liver microsomes and to have a radiation-protective effect on cells. PBP 10 has also been shown to inhibit tumor growth in mice. The mechanism of action is not yet clear, but it is believed that PBP 10 may bind to cellular proteins or DNA.</p>Formula:C84H126N24O15Purity:Min. 95%Molecular weight:1,712.1 g/molDiptoindonesin G
CAS:<p>Diptoindonesin G is a peptide that is an activator of the dipeptidyl peptidase-4 receptor. It binds to the receptor and inhibits the breakdown of the incretin hormones, which regulate blood glucose levels. This drug has been shown to be a potent inhibitor of ion channels, such as Na+ and Ca2+, in addition to being an antibody binding site for human IgG. Diptoindonesin G is also found to be a ligand for the angiotensin II type 1 receptor, which plays a role in regulating blood pressure and fluid balance.</p>Formula:C21H12O6Purity:Min. 95%Molecular weight:360.3 g/molErastin2
CAS:<p>Erastin2 is a small molecule, which is a synthetic compound designed to induce ferroptosis, a form of regulated cell death. It is derived through chemical synthesis and belongs to the class of compounds known as ferroptosis inducers. The mode of action of Erastin2 involves the selective inhibition of the cystine/glutamate antiporter, also known as the system Xc-. This inhibition leads to depletion of intracellular cysteine and subsequent disruption of glutathione synthesis, ultimately resulting in the accumulation of reactive oxygen species (ROS) and lipid peroxidation.</p>Formula:C36H35ClN4O4Purity:Min. 95%Molecular weight:623.14 g/molNHS-m-dPEG® (MW = 685)
CAS:<p>NHS-m-dPEG® (MW = 685) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-m-dPEG® (MW = 685) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Purity:Min. 95%Molecular weight:685.75 g/molATG5 antibody
<p>ATG5 antibody was raised in rabbit using the middle region of ATG5 as the immunogen</p>Purity:Min. 95%D-Arginyl-[Hyp3,Thi5,8,D-Phe7]-Bradykinin
<p>D-Arginyl-[Hyp3,Thi5,8,D-Phe7]-Bradykinin is a biochemicals that acts as an antagonist of bradykinin. Bradykinins are peptides that are active in the human body and have a variety of physiological effects. D-Arginyl-[Hyp3,Thi5,8,D-Phe7]-Bradykinin has been shown to inhibit the release of neurotransmitters from nerve cells and has anti-inflammatory properties. It also has been shown to inhibit the activity of protein kinase C.</p>Formula:C56H83N19O13S2•2CH3COOH•4H2OPurity:Min. 95%Molecular weight:1,486.67 g/molLOC344065 antibody
<p>LOC344065 antibody was raised in rabbit using the N terminal of LOC344065 as the immunogen</p>Purity:Min. 95%BAY-X 1005
CAS:<p>Bay-X 1005 is a nonsteroidal anti-inflammatory drug that belongs to the class of ester linkages. It is used to treat inflammatory bowel disease and other autoimmune diseases such as rheumatoid arthritis, psoriasis, Crohn's disease, ulcerative colitis, and lupus erythematosus. Bay-X 1005 inhibits the production of PGE2 in inflamed tissue by blocking cyclooxygenase activity. This drug also has been shown to have an effect on cell factor (CD40) and stem cell factor (SCF), which are involved in inflammation. Bay-X 1005 binds to the cell receptor for SCF and blocks its ability to activate T cells and B cells. This leads to a decrease in inflammation by reducing the number of activated T cells that produce cytokines. The hydroxyl group on Bay-X 1005 may be responsible for this effect.</p>Formula:C23H23NO3Purity:Min. 95%Molecular weight:361.43 g/molLMP744
CAS:<p>LMP744 is a phosphodiesterase inhibitor that has been shown to be cytotoxic in vitro. It is also a pro-apoptotic protein, which leads to the induction of apoptosis by binding to the mitochondrial membrane and inhibiting the release of cytochrome C. LMP744 acts as an intercalating agent and binds to dna, preventing transcription and replication. This drug also inhibits DNA synthesis and is homologous with other drugs that are being developed for cancer treatment. A significant cytotoxicity was observed in human tumor cells, but not in normal cells, at concentrations of 10 μM or less. The terminal half-life of LMP744 was 15 hours when administered intravenously in rats. The drug exhibits high affinity for methoxy groups, which may be due to its quinoline structure.</p>Formula:C24H24N2O7Purity:Min. 95%Molecular weight:452.5 g/molTTC-352
CAS:<p>TTC-352 is a small molecule that selectively modulates the activity of certain ion channels. It is an inhibitor of the Kv1.3 channel, which is expressed in neurons and dorsal root ganglion cells. TTC-352 has been shown to inhibit neuronal activity and to be an effective analgesic when used in combination with morphine. TTC-352 has also been shown to have anticancer properties as an inhibitor of epidermal growth factor receptor (EGFR) signaling and as a potential treatment for metastatic melanoma. The ligand binds to the receptor, preventing it from binding to its natural ligands, inhibiting downstream signaling pathways. This inhibition leads to cell death by apoptosis or necrosis depending on the type of cancer cell.</p>Formula:C20H13FO3SPurity:Min. 95%Color and Shape:PowderMolecular weight:352.40 g/molFenquinotrione
CAS:<p>Fenquinotrione is an anticancer drug that belongs to the class of inhibitors known as protein kinase inhibitors. It is a Chinese medicinal analog that has been shown to inhibit tumor growth by inducing apoptosis in cancer cells. Fenquinotrione acts as an inhibitor of kinases, which are enzymes involved in cell signaling and regulation. This drug has been found to be effective against various types of cancer, including lung, breast, and colon cancer. Fenquinotrione inhibits the activity of certain kinases involved in cancer cell proliferation and survival. It also blocks the formation of new blood vessels that supply nutrients to tumors, thereby preventing their growth. Fenquinotrione is excreted primarily through urine and has a favorable safety profile with minimal side effects.</p>Formula:C22H17ClN2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:424.8 g/molAc-Lys-Thr-Lys-Gln-Leu-Arg-AMC
<p>Ac-Lys-Thr-Lys-Gln-Leu-Arg-AMC is a peptide that is used as a research tool in the study of protein interactions. Ac-Lys-Thr-Lys-Gln-Leu-Arg-AMC binds to the acetylcholine receptor (AChR) at the interface between two subunits, which inhibits the formation of ion channels and blocks neurotransmission. This peptide has been shown to be a potent inhibitor of AChR activation by nicotinic agonists, such as acetylcholine (ACh), nicotine, and carbachol. Acetylcholine binding to AChRs induces conformational changes in the receptor that are transmitted across the synapse to activate postsynaptic receptors on muscle cells. Acetylcholine binding triggers an allosteric change in the AChR that results in increased permeability of ion channels, leading to depolarization of</p>Formula:C45H73N13O11Purity:Min. 95%Molecular weight:972.14 g/molPC945
CAS:<p>PC945 is a potent protein kinase inhibitor that has been shown to induce apoptosis in cancer cells. This Chinese analog of rifampicin inhibits the activity of kinases, which are enzymes that play a critical role in cell signaling and regulation. PC945 has been found to be effective against several types of cancer, including human lung and prostate cancer. This inhibitor also exhibits anti-tumor activity by blocking the growth and proliferation of tumor cells. Additionally, PC945 has been found to have potential as an anticancer agent due to its ability to inhibit the growth of cancer cells in vitro and in vivo. Its efficacy has also been tested in urine samples from patients with bladder cancer, where it showed promising results as a potential diagnostic tool for this disease.</p>Formula:C38H37F3N6O3Purity:Min. 95%Molecular weight:682.7 g/molPF 03814735
CAS:<p>Inhibitor of Aurora kinase</p>Formula:C23H25F3N6O2Purity:Min. 95%Color and Shape:PowderMolecular weight:474.48 g/molTroponin I protein (Cardiac) (Mouse)
<p>Purified native Mouse Troponin I protein (Cardiac)</p>Purity:Min. 95%W-2429
CAS:<p>W-2429 is a drug with antipyretic and analgesic properties. It has been shown to have pharmacological properties, including sedative, hypnotic, and anticonvulsant effects. W-2429 is not active against gram-positive bacteria, such as Staphylococcus aureus or Streptococcus pneumoniae.</p>Formula:C10H8N2O2Purity:Min. 95%Molecular weight:188.18 g/molC8ORF34 antibody
<p>C8ORF34 antibody was raised using the N terminal Of C8Orf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK</p>RSV antibody
<p>RSV antibody was raised in rabbit using residues 201-211 [KQLLPIVNKQSC] of the 63 kDa RSV F protein as the immunogen.</p>Purity:Min. 95%CREM antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. With its high frequency of human activity, it has been extensively studied using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>U 46619
CAS:<p>U 46619 is an analog of the peptide neurotransmitter acetylcholine. It is a potent and specific agonist for the nicotinic acetylcholine receptor (nAChR) in cardiac muscle cells. U 46619 binds to the cation channel on the nAChR, leading to changes in membrane potential and increased calcium influx. This drug has been shown to have positive effects on ventricular myocytes by increasing whole-cell voltage-clamp currents in rat cardiomyocytes. The biological properties of U 46619 have been investigated using an experimental model with maternal blood as a source of antibodies against acetylcholine, which was used to detect binding of radioactively labeled U 46619 to the receptors in the blood serum. Clinical studies have demonstrated that this drug may be useful for treating patients with heart failure or arrhythmias.</p>Formula:C21H34O4Purity:Min. 95%Molecular weight:350.5 g/molAZD 8186
CAS:<p>AZD 8186 is a selective small-molecule inhibitor, which is sourced from synthesized chemical compounds, specifically designed to target the phosphoinositide 3-kinase (PI3K) pathway. This inhibitor functions by selectively inhibiting the PI3K isoforms, primarily PI3Kβ and PI3Kδ, which play critical roles in multiple cell signaling pathways related to growth, survival, and proliferation.</p>Formula:C24H25F2N3O4Purity:Min. 95%Molecular weight:457.5 g/molN2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine
CAS:<p>N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine is a peptide and an inhibitor of ion channels. It was originally isolated from the venom of the Brazilian spider Phoneutria nigriventer. N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine binds to voltage gated sodium channels, inhibiting the opening of these channels. This inhibition prevents the propagation of action potentials, and leads to a cessation in neural activity. N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine also inhibits potassium channels by binding to the S4 region of these channels. The inhibition of potassium channels leads to hyperpolarization and a decrease in neural activity.</p>Formula:C20H40N2O3Purity:Min. 95%Molecular weight:356.5 g/mol4-(4-Bromo-phenyl)-1-(5-methoxy-1H-indol-3-ylmethyl)-piperidin-4-ol
CAS:<p>4-(4-Bromo-phenyl)-1-(5-methoxy-1H-indol-3-ylmethyl)-piperidin-4-ol is a potent and selective activator of the human TRPA1 receptor. It has been shown to activate the channel and induce calcium influx in human embryonic kidney cells. This compound can also be used as a research tool to study protein interactions and pharmacology. The purity of this product is high, with no detectable impurities. 4-(4-Bromo-phenyl)-1-(5-methoxy-1H-indol-3-ylmethyl)-piperidin-4 -ol is available for purchase from Sigma Aldrich at CAS No. 8734456044.</p>Formula:C21H23BrN2O2Purity:Min. 95%Molecular weight:415.3 g/molRIOK3 antibody
<p>RIOK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLA</p>Purity:Min. 95%Pig IgM
<p>Pig IgM is a chimeric protein that belongs to the family of immunoglobulins. It is a monoclonal antibody that has been purified and is used in Life Sciences research. Pig IgM specifically targets amyloid plaques, which are abnormal protein deposits found in various diseases, such as Alzheimer's disease. This antibody-drug complex can be used for the detection and quantification of amyloid plaques in brain tissue samples. Pig IgM has high affinity and specificity for the target antigen, making it an ideal tool for researchers studying amyloid-related disorders. Additionally, this antibody can be used in immunoassays to measure the levels of brain natriuretic peptide (BNP), a hormone involved in regulating blood pressure and fluid balance, in human serum samples. The use of Pig IgM in these assays ensures accurate and reliable results due to its high sensitivity and low background interference.</p>Purity:Min. 95%Mogroside I E1
CAS:<p>Mogroside I E1 is a sweetener that is structurally related to mogrosides. It has been shown to inhibit the dna polymerase activity and reduce cancer cell proliferation. This product was developed as a health-care product for the treatment of diabetes, obesity, and hypertension. Mogroside I E1 is also used as a flavoring agent in food products. Mogroside I E1 is synthesized from mogrosides by dehydration of the sugar moiety with alcohols and oxidation of the sugar moiety with hydrogen peroxide or sodium persulfate.</p>Formula:C36H62O9Purity:Min. 95%Molecular weight:638.87 g/molIlorasertib hydrochloride
CAS:<p>Ilorasertib hydrochloride is a selective multi-targeted kinase inhibitor, which is derived from meticulous synthetic chemistry processes aimed at producing potent therapeutic agents. With a primary mechanism of action that involves the inhibition of several key kinases, Ilorasertib hydrochloride acts to disrupt critical signaling pathways essential for cancer cell proliferation and survival. This mechanistic approach involves the targeting of enzymes such as cyclin-dependent kinases (CDKs) and VEGFR, which are pivotal in various cancerous processes.</p>Formula:C25H22ClFN6O2SPurity:Min. 95%Molecular weight:525 g/molTn antigen antibody (Prediluted for IHC)
<p>Mouse monoclonal Tn antigen antibody (Prediluted for IHC)</p>Purity:Min. 95%Roxatidine acetate
CAS:<p>Roxatidine acetate is a prodrug that is metabolized to roxatidine, its active form, in the liver. Roxatidine acetate has been shown to have antioxidative properties, which may be due to its ability to inhibit the production of reactive oxygen species. It also prevents the accumulation of fatty acid in the kidneys and reduces glomerular filtration rate. Roxatidine acetate binds to integrin receptors on oral pathogens, preventing them from attaching to host tissue and causing infection. This drug has been shown to be effective against a number of oral pathogens, including Streptococcus mutans, Enterococcus faecalis, Helicobacter pylori, Lactobacillus acidophilus, and Candida albicans. Roxatidine acetate is not metabolized by cytochrome P450 enzymes or glucuronidases and does not interact with other drugs or food components.</p>Formula:C19H28N2O4Purity:Min. 95%Molecular weight:348.4 g/molRabbit anti Hamster IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>Purity:Min. 95%DSHN
CAS:<p>DSHN is a natural product that has been shown to have a modulating effect on tyrosine phosphatases, which are enzymes that regulate cellular signaling. DSHN also has been shown to inhibit inflammatory responses in vitro and in vivo. It was found to be effective in inhibiting the activation of p65, one of the transcription factors involved in the inflammatory response. In addition, it has been demonstrated that DSHN inhibits the production of pro-inflammatory cytokines such as IL-1β and TNF-α. These effects were observed using transcriptomic analysis on mouse macrophages.</p>Formula:C15H17NO5SPurity:Min. 95%Molecular weight:323.4 g/molVitamin ck3
CAS:<p>Vitamin C is a water-soluble vitamin that is required for the synthesis of collagen and carnitine. It has been shown to have potential use in cancer therapy, as it has an inhibitory effect on primary tumor growth. Vitamin C also induces apoptosis in cancer cells and inhibits tumor growth. The antitumor effects of Vitamin C are mediated by its capacity to induce cellular differentiation, which may be due to its ability to integrate into the DNA and RNA molecules. This vitamin also has an inhibitory effect on bladder cancer cells, especially when used with cisplatin.</p>Formula:C17H16Na2O11SPurity:Min. 95%Molecular weight:474.35 g/molMLS6585
CAS:<p>MLS6585 is a functional allosteric modulator of the dopamine D2 receptor. It has been shown to increase the affinity and inhibitory effect of dopamine at the D2 receptor. MLS6585 was found to have a significant effect on neuronal function in rats, reversing dyskinesia and improving motor function. This drug also reduced blood pressure and had an anti-inflammatory effect in mice. MLS6585 is currently being developed as a treatment for Parkinson's disease, depression, and hypertension.</p>Formula:C19H23N3O2SPurity:Min. 95%Molecular weight:357.5 g/molSR 13800
CAS:<p>SR 13800 is a nutritional supplement that contains branched-chain amino acids. It is used to help transport the active substances into muscle cells. This supplement has been shown to increase the uptake of amino acids by mammalian cells in culture and has an oral bioavailability of 100%. SR 13800 is not currently available in any other form besides a powder. It can be dissolved in water and consumed as a drink, or mixed with food. The product does not contain any other ingredients besides amino acids and does not require refrigeration.</p>Formula:C25H29N3O2SPurity:Min. 95%Molecular weight:435.6 g/mol4-Desfluoro-6-fluoro dolutegravir
CAS:<p>Please enquire for more information about 4-Desfluoro-6-fluoro dolutegravir including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H19F2N3O5Purity:Min. 95%Molecular weight:419.4 g/molAmino-dPEG®12-t-boc-Hydrazide
CAS:<p>Amino-dPEG®12-t-boc-Hydrazide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-t-boc-Hydrazide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C32H65N3O15Purity:Min. 95%Molecular weight:731.87 g/molAzido-dPEG® 8-NHS ester
CAS:<p>Azido-dPEG® 8-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG® 8-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Purity:Min. 95%Molecular weight:564.58 g/molSLC7A1 antibody
<p>SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF</p>Purity:Min. 95%Syntaxin 19 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STX19 antibody, catalog no. 70R-3408</p>Purity:Min. 95%BX517
CAS:<p>BX517 is a peptide that was designed to activate the human death receptor 4 (DR4). DR4 is a member of the tumor necrosis factor receptor superfamily, which includes receptors for TNF-α and TNF-β. BX517 has been shown to inhibit ion channels and protein interactions. This inhibitor has also been proven to be an effective anti-cancer drug in animal models.</p>Formula:C15H14N4O2Purity:Min. 95%Molecular weight:282.3 g/molAmino-dPEG®4-t-boc-hydrazide
CAS:<p>Amino-dPEG®4-t-boc-hydrazide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-t-boc-hydrazide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H33N3O7Purity:Min. 95%Molecular weight:379.45 g/molAlarmine-d6
CAS:<p>Please enquire for more information about Alarmine-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12N2Purity:Min. 95%Molecular weight:142.23 g/molPseudocantharidin C
CAS:<p>Pseudocantharidin C is a natural compound that belongs to the family of hydroquinones. It has been shown to inhibit transcription and RNA synthesis in human cells through the activation of protein kinases and phosphatases. Pseudocantharidin C also inhibits viral mRNA production, which may be due to its ability to induce messenger RNA degradation. The pseudocantharidin C-induced inhibition of transcription correlates with its ability to prevent neuronal atrophy in adult mice, as well as preventing splicing defects in motoneurons from infant mice.</p>Formula:C15H16BrNO2Purity:Min. 95%Molecular weight:322.2 g/mol3-AQC
CAS:<p>3-AQC is a mitochondrial respiratory chain inhibitor that inhibits electron transport and the production of ATP. 3-AQC is taken up by mitochondria and functions in the respiratory chain. The drug has significant effects on cellular organelles, such as the cell membrane, and can be used to study mitochondrial functions. The drug was found to have significant effects on cardiomyocytes, leading to cardiac dysfunction in neonatal rats.</p>Formula:C20H21N5O4Purity:Min. 95%Molecular weight:395.4 g/molAPEH Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APEH antibody, catalog no. 70R-2582</p>Purity:Min. 95%PRDX1 antibody
<p>The PRDX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to PRDX1, a protein involved in various cellular processes. This antibody has been shown to inhibit collagen production and the activity of certain enzymes, making it a potential therapeutic option for conditions related to collagen disorders and enzyme dysregulation. Additionally, the PRDX1 antibody has cytotoxic properties, meaning it can induce cell death in specific cell types. It can also be used as a tool in laboratory experiments to detect and quantify PRDX1 levels in samples. With its ability to target PRDX1 and modulate its function, this antibody holds promise for developing novel treatments and understanding the role of PRDX1 in different biological pathways.</p>FT827
CAS:<p>FT827 is a small molecule that is a covalent inhibitor of ubiquitin ligases. FT827 inhibits the activity of the proteasome by inhibiting ubiquitin ligases and proteasome-dependent protein degradation. FT827 has been shown to inhibit cancer growth in organoids, as well as infection by Borrelia burgdorferi, an agent of Lyme disease. FT827 was also shown to inhibit the replication of rabies virus in vitro. The precise molecular mechanism of action for this drug remains unknown, but it may be due to its ability to inhibit ubiquitin ligases.<br>!--END--></p>Formula:C27H28N6O5SPurity:Min. 95%Molecular weight:548.6 g/molTropomyosin protein
<p>Tropomyosin protein is a lipoprotein lipase that plays a crucial role in various cellular processes. It is involved in the regulation of lipase activity and has been found to be associated with the development of certain diseases, such as breast cancer. Tropomyosin protein has been studied extensively in the field of Life Sciences and has shown potential as a target for therapeutic interventions. Monoclonal antibodies against tropomyosin protein have been developed and have demonstrated neutralizing effects on its activity. These antibodies can be used in research and diagnostic applications to study antigen-antibody reactions and to detect tropomyosin protein levels in biological samples. The availability of native proteins and antigens allows for accurate and reliable measurements, contributing to advancements in the understanding of this important biomolecule.</p>Purity:Min. 95%DOTA-tris(Acid)-Amido-dPEG®11-Maleimide
<p>DOTA-tris(Acid)-Amido-dPEG®11-Maleimide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(Acid)-Amido-dPEG®11-Maleimide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Purity:Min. 95%Molecular weight:1,310.24 g/molNCI172112
CAS:<p>NCI172112 is a human immunoglobulin that has been genetically engineered to be resistant to proteolytic degradation by serine proteases. It binds to the surface of cancer cells and blocks the growth of tumor cells in culture. NCI172112 has also been shown to reduce cardiac hypertrophy in animals, which may be due to its ability to decrease fatty acid levels in the heart. The covalent linkage between NCI172112 and human serum albumin prevents it from being easily degraded by enzymes in the body. NCI172112 has also been shown to have a diagnostic effect on cancerous tissue and can be used as a treatment for cancer.</p>Formula:C14H23Cl2N3O2Purity:Min. 95%Molecular weight:336.3 g/molAGN 193109
CAS:<p>Pan-retinoic acid receptor (RAR) antagonist</p>Formula:C28H24O2Purity:Min. 95%Molecular weight:392.49 g/molMac glucuronide phenol-linked sn-38
CAS:<p>Mac glucuronide phenol-linked SN-38 is a chemically engineered prodrug derived from irinotecan. This compound serves as a targeted therapeutic agent, designed to enhance the delivery and activation of SN-38, an active metabolite, at tumor sites. The source of this product arises from the selective conjugation of SN-38 with a glucuronide moiety, linked through a phenolic connector, enabling preferential release in the tumor microenvironment.</p>Formula:C50H54N6O20SPurity:Min. 95%Molecular weight:1,091.06 g/molJunctophilin 1 antibody
<p>Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids KESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNSIMIVLVMLLNI</p>2-Amino-6-(p-chlorobenzyl)-4H-5,6,7,8-tetrahydrothiazolo (5,4-D)azepine
CAS:<p>2-Amino-6-(p-chlorobenzyl)-4H-5,6,7,8-tetrahydrothiazolo (5,4-D)azepine is a potent inhibitor of the enzyme protein phosphatase 2A. It has a binding affinity for the active site of this enzyme and inhibits its activity. This compound is used as a research tool to study protein interactions and activation. The compound has been shown to be a ligand for ion channels and receptors. 2-Amino-6-(p-chlorobenzyl)-4H-5,6,7,8 -tetrahydrothiazolo (5,4-D)azepine is not expected to have any significant adverse effects on humans because it does not bind to human proteins or tissues.</p>Formula:C14H18Cl3N3SPurity:Min. 95%Molecular weight:366.7 g/molp15 Treponema Pallidum protein
<p>Purified recombinant p15 Treponema Pallidum protein</p>Purity:Min. 95%Axitinib sulfoxide
CAS:<p>Axitinib sulfoxide is a small molecule metabolite, which is derived from the parent compound axitinib. Axitinib, a tyrosine kinase inhibitor, targets vascular endothelial growth factor receptors (VEGFRs), primarily utilized in oncological therapeutics. The source of axitinib sulfoxide is the metabolic transformation of axitinib in vivo, involving the oxidation of sulfur atoms by hepatic metabolic enzymes, particularly cytochrome P450.</p>Formula:C22H18N4O2SPurity:Min. 95%Molecular weight:402.5 g/molKeratin K10 antibody
<p>Keratin K10 antibody was raised in Guinea Pig using synthetic peptide of human keratin K10 coupled to KLH as the immunogen.</p>Purity:Min. 95%DL5050
CAS:<p>DL5050 is a biodegradable, non-steroidal anti-inflammatory drug that belongs to the class of androstane receptor agonists. It has been shown to have a long-acting effect in vivo. DL5050 is not selective for any particular androgen receptor, but rather it binds to the constitutive androstane receptor, which is found in cells throughout the body. This active compound binds to the multilayer sensor with functional groups of ethylene molecules that are attached to it. The sensor then triggers a change in the ion channels located on the cell membrane surface, which leads to an increase in intracellular calcium levels. The increased calcium level activates enzymes that break down arachidonic acid (a polyunsaturated fatty acid) into prostaglandins. These enzymatic reactions lead to inflammation relief and pain reduction.</p>Formula:C23H15Cl2N3O2Purity:Min. 95%Molecular weight:436.3 g/molValspodar
CAS:<p>P-glycoprotein (MDR1) inhibitor; non-immunosuppressive cyclosporin A analog</p>Formula:C63H111N11O12Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:1,214.62 g/molKCNH5 antibody
<p>KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH</p>LUF7244
CAS:<p>LUF7244 is a pharmaceutical agent, which is a synthetic compound derived from rational drug design. Its primary source is laboratory synthesis utilizing advanced organic chemistry techniques. The mode of action of LUF7244 involves selective antagonism of specific receptor subtypes, allowing for precise modulation of receptor activity. This antagonistic behavior is achieved through competitive binding at the receptor site, inhibiting the natural ligand interaction and subsequent signaling pathways.</p>Formula:C16H16ClN3O2S2Purity:Min. 95%Molecular weight:381.9 g/molHCH6-1
CAS:<p>HCH6-1 is a synthetic compound that modulates the activity of inflammatory cells such as neutrophils. HCH6-1 inhibits the production of interleukin-8 and other proinflammatory cytokines by neutrophils, which are important for chemotaxis. This compound has been shown to inhibit the activation of neutrophils in a concentration-dependent manner. HCH6-1 has also been shown to be effective in reducing inflammation in animal models of inflammatory diseases such as colitis.</p>Formula:C28H27N3O4Purity:Min. 95%Molecular weight:469.5 g/molCDC26 antibody
<p>CDC26 antibody was raised in rabbit using the C terminal of CDC26 as the immunogen</p>Purity:Min. 95%14:0 Pc-d63
CAS:Controlled Product<p>14:0 Pc-d63 is a ligand that binds to the receptor site of GABA-A receptors. It has been shown to be an activator of this receptor, which may be due to its ability to bind and activate the ion channels in these receptors. 14:0 Pc-d63 can also bind to other proteins, inhibiting their activity. This ligand has been used as a research tool in cell biology, peptide chemistry, and antibody development.</p>Formula:C36H9NO8PD63Purity:Min. 95%Molecular weight:741.32 g/molPi4Ka inhibitor-A1
CAS:<p>Pi4Ka inhibitor-A1 is a peptide that is used in research as an activator or inhibitor of protein interactions. Pi4Ka inhibitor-A1 may be used to study the function of ion channels and receptors, and has been shown to inhibit the function of ligand-gated ion channels, such as nicotinic acetylcholine receptors. It is also used in pharmacology to study the binding of ligands, such as neurotransmitters, to receptors. This peptide has high purity and a CAS number of 1416334-69-4.</p>Formula:C29H27FN6O4SPurity:Min. 95%Molecular weight:574.6 g/molCD40 antibody (Azide Free)
<p>CD40 antibody (Azide free) was raised in rat using CD40 as the immunogen</p>Enkephalin antibody
<p>Enkephalin antibody was raised in rabbit using synthetic met-enkephalin (Sigma) conjugated toBSA as the immunogen.</p>Purity:Min. 95%GS-4997
CAS:<p>GS-4997 is an ion channel activator that increases the conductance of potassium ions through the cell membrane. It has been shown to act as a positive allosteric modulator of NMDA receptors, and it has been used in research as a tool for studying protein interactions. GS-4997 is a peptide with high purity and low endotoxin levels. It has been shown to be an inhibitor of acetylcholine esterase, which may contribute to its mechanism of action.</p>Formula:C22H17ClFN9OPurity:Min. 95%Molecular weight:477.9 g/molTetraspanin 6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN6 antibody, catalog no. 70R-5977</p>Purity:Min. 95%HNRPM antibody
<p>HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE</p>N-((1,3-Dihydroxypropan-2-yl)oxy)-7-fluoro-6-((2-fluoro-4-iodophenyl)amino)benzofuran-5-carboxamide
CAS:<p>N-((1,3-Dihydroxypropan-2-yl)oxy)-7-fluoro-6-(2-fluoro-4-iodophenyl)amino)benzofuran-5 -carboxamide (BX795) is a potent and selective inhibitor of the immune checkpoint protein PD1, which is expressed on T cells. This drug binds to the extracellular domain of PD1 and blocks its interaction with the ligands PDL1 and PDL2. BX795 inhibits the activation of T cells by blocking the signal transduction pathway induced by PD1 binding to its ligands. This drug has been shown to have an excellent safety profile in preclinical studies and will be tested in clinical trials for cancer immunotherapy.</p>Formula:C18H15F2IN2O5Purity:Min. 95%Molecular weight:504.2 g/molMethamphetamine antibody
<p>Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.</p>Primidone - Bio-X ™
CAS:Controlled Product<p>Primidone is an antiepileptic drug that is used to treat seizures. This drug alters transmembrane sodium and calcium channel transport, which in return reduces the frequency of nerve firing.</p>Formula:C12H14N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:218.25 g/molKeratin 8 antibody
<p>The Keratin 8 antibody is a disulfide bond-based polyclonal antibody that specifically targets and detects the presence of Keratin 8. This antibody is commonly used in life sciences research, particularly in studies involving cell biology and molecular biology. It can be used for various applications such as immunohistochemistry, western blotting, and ELISA.</p>Pennogenin 3-O-β-chacotrioside
CAS:<p>Pennogenin 3-O-beta-chacotrioside is a molecule that is found in the natural product dracaena and has been shown to have anti-cancer properties. It inhibits the growth of cancer cells and induces autophagy, which is an important physiological process for removing damaged organelles. Pennogenin 3-O-beta-chacotrioside also inhibits the production of tumorigenic factors and has bacteriostatic activity against bacteria. This compound also has antifungal, antiviral, and antiparasitic activities.</p>Formula:C45H72O17Purity:Min. 95%Molecular weight:885.04 g/molTegaserod
CAS:<p>5-HT4 serotonin receptor antagonist; used to treat irritable bowel syndrome</p>Formula:C16H23N5OPurity:Min. 95%Molecular weight:301.39 g/mol16:0(d4) Coenzyme A
CAS:Controlled Product<p>16:0(d4) Coenzyme A is an ion channel ligand that belongs to the class of reagents for pharmacology, cell biology and biochemistry. This product has been shown to activate calcium-dependent potassium channels in a dose-dependent manner. It also inhibits voltage-gated sodium channels by binding to the receptor site on the extracellular domain of the channel protein. 16:0(d4) Coenzyme A is a high purity product that will not interfere with other experiments. 16:0(d4) Coenzyme A may be used as an inhibitor to prevent activation of potassium channels or as an activator to inhibit voltage-gated sodium channels.</p>Formula:C37H71D4N10O17P3SPurity:Min. 95%Molecular weight:1,061.06 g/molHX 630
CAS:<p>Retinoid X receptor (RXR) agonist</p>Formula:C28H27NO2SPurity:Min. 95%Molecular weight:441.59 g/molFlosulide
CAS:<p>Flosulide is a novel, non-steroidal anti-inflammatory drug that has been shown to have inhibitory properties in vitro. Flosulide is a prodrug that is converted into the active form flosulide hydrochloride in vivo. The binding of flosulide to its receptor cb2 prevents the production of arachidonic acid, which would otherwise be metabolized into inflammatory prostaglandins (e.g., thromboxane). Flosulide also inhibits the production of epidermal growth factor (EGF) and glomerular filtration rate (GFR). This drug has long-term efficacy and can be used for treatment of metabolic disorders such as diabetes mellitus.</p>Formula:C16H13F2NO4SPurity:Min. 95%Molecular weight:353.3 g/molNeryl bromide
CAS:<p>Neryl bromide is a potent inhibitor of protein kinase and chitinase, making it a promising candidate for cancer therapy. It has been shown to induce apoptosis in human cancer cells and Chinese hamster ovary cells. Neryl bromide also exhibits anticancer activity against various tumor types, including breast, prostate, and lung cancers. In addition to its medicinal properties, this compound is also used as a heparin antagonist and can be found in urine samples from individuals exposed to certain environmental toxins. Its ability to selectively target cancer cells while leaving healthy cells unharmed makes it an attractive option for future cancer treatments.</p>Formula:C10H17BrPurity:Min. 95%Molecular weight:217.15 g/mol(S,R,R)-2-(2,2-Diphenyl-[1,3]dioxolan-4-yl)-piperidine
CAS:<p>(S,R,R)-2-(2,2-Diphenyl-[1,3]dioxolan-4-yl)-piperidine is a peptide that can be used as a research tool. It has been shown to activate the potassium channel Kv1.1 and inhibit the calcium channel Cav1.1 in rat and guinea pig neurons. It also inhibits the activity of acetylcholine esterase and protein kinase C in rat brain tissue. (S,R,R)-2-(2,2-Diphenyl-[1,3]dioxolan-4-yl)-piperidine binds to the antibody IgG with high affinity and specificity. The binding is reversible and competitively inhibited by an excess of free ligand. This peptide has potential for use as a pharmaceutical agent for treating autoimmune diseases such as multiple sclerosis or rheumatoid arthritis.</p>Formula:C20H23NO2Purity:Min. 95%Molecular weight:309.4 g/molINSIG2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG2 antibody, catalog no. 70R-6929</p>Purity:Min. 95%BRD3731
CAS:<p>BRD3731 is a potent tumor inhibitor that has been used in traditional Chinese medicine for centuries. This medicinal compound has been isolated from human urine and has shown to be effective against leukemia and other cancer cells. BRD3731 works by inhibiting the activity of kinases, which are proteins that play a key role in cell cycle regulation and apoptosis. By blocking the activity of these kinases, BRD3731 prevents cancer cells from dividing and growing, leading to their death. This compound belongs to a class of kinase inhibitors that have shown promising results in preclinical studies for the treatment of various types of cancer. With its potent anti-cancer properties, BRD3731 holds great promise as a potential therapeutic agent for patients with cancer.</p>Formula:C24H31N3OPurity:Min. 95%Molecular weight:377.5 g/molCD80 antibody
<p>The CD80 antibody is a collagen-based monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the CD80 protein, which is an important immune checkpoint molecule involved in T-cell activation. The antibody has been shown to effectively block the interaction between CD80 and its receptor, leading to the inhibition of T-cell activation and proliferation.</p>ZNF431 antibody
<p>ZNF431 antibody was raised in rabbit using the N terminal of ZNF431 as the immunogen</p>Purity:Min. 95%Gö 7874, hydrochloride
CAS:<p>Gö 7874 is a peptide that activates the potassium ion channels in cells. Inhibiting these channels prevents the flow of potassium ions into the cell, which causes a decrease in the membrane potential and ultimately leads to cell death. Gö 7874 has been shown to inhibit various types of ion channels, including voltage-gated sodium and calcium channels as well as potassium channels. This peptide binds to receptors on cells, which leads to an increase in intracellular calcium levels. Gö 7874 has been used extensively as a research tool for studying receptor interactions and protein interactions with ligands.</p>Formula:C27H26N4O4·HClPurity:Min. 95%W146
CAS:<p>W146 is a small molecule inhibitor of matrix metalloproteinase-9 (MMP-9) that has been shown to be neuroprotective in an animal model of cerebral ischemia. It attenuated neuronal death and reduced the expression of pro-inflammatory cytokines and chemokines after transient focal cerebral ischemia. W146 binds to the active site of MMP-9, preventing it from cleaving a critical protein substrate, which prevents the activation of downstream signaling pathways. This drug also inhibits transcriptional activity and polymerase chain reaction (PCR). W146 has been shown to have anti-inflammatory properties in granulosa cells by inhibiting the production of cytokines and chemokines, such as IL-1β, IL-6, IL-8, TNFα, and MCP-1.</p>Formula:C16H27N2O4PPurity:Min. 95%Molecular weight:342.37 g/molPentagamavunon-1
CAS:<p>Pentagamavunon-1 is an activator of the pentagamma subunit of the ligand-gated ion channel. It binds to the receptor and activates it, causing a change in the permeability of cells. Pentagamavunon-1 can be used as a research tool or as an inhibitor in cell biology.</p>Formula:C23H24O3Purity:Min. 95%Molecular weight:348.4 g/molDOK2 antibody
<p>DOK2 antibody was raised in rabbit using the C terminal of DOK2 as the immunogen</p>Big Gastrin, human
CAS:<p>Big Gastrin, is a hormone which exerts its effects through activating the G-protein coupled receptor CCK2R and plays a role in gastric acid secretion. Big Gastrin can be used in research applications such as pharmacology and cell biology. This product is also a potential growth factor in some cancer tumors, including prostate cancer. It is available as an ammonium salt and as a 0.1mg vial.</p>Formula:C176H251N43O53SPurity:Min. 95%Molecular weight:3,849.2 g/molHSMG-1 inhibitor 11E
CAS:<p>HSMG-1 inhibitor 11E is a small molecule that binds to the HSMG-1 ion channel and inhibits its activity. This compound has been shown to be an activator of the HSMG-1 ion channel, but is an inhibitor of the HSMG-2 ion channel. It is a high purity chemical with a CAS number of 1402452-10-1.</p>Formula:C26H27N7O3SPurity:Min. 95%Molecular weight:517.6 g/molHG1 Toxin
<p>HG1 toxin is a peptide that is found in the venom of the scorpion Heterometrus fulvipes. It is a member of the short-chain scorpion toxins, which are composed of a single chain of amino acids. This protein has been shown to bind to potassium channels and inhibit their function, leading to paralysis of the prey's nervous system. HG1 toxin has been shown to be able to activate or inhibit ion channels and other receptors. It can also bind to ligands such as peptides or antibodies and affect cellular activity. HG1 toxin is produced by recombinant DNA technology and purified by HPLC for use in biochemical research and pharmacological studies.</p>Purity:Min. 95%KAT681
CAS:<p>KAT681 is a peptide that is an activator of the potassium ion channel Kv1.2 and an inhibitor of the calcium ion channel Cav1.2. It has been shown to inhibit the ability to induce pain in animal models, suggesting it may be a potential therapeutic agent for treatment of chronic pain. KAT681 has also been shown to inhibit protein interactions with receptors and ligands, as well as act as a pharmacological tool for studying protein interactions in cell biology studies.</p>Formula:C24H21FNNaO6Purity:Min. 95%Molecular weight:461.4 g/molInfigratinib phosphate
CAS:Controlled Product<p>Infigratinib phosphate is a tyrosine kinase inhibitor that inhibits the growth of cells by blocking the receptor tyrosine kinases. It has been shown to be effective in treating urothelial carcinoma, cholangiocarcinoma, and other cancers. Infigratinib is a selective inhibitor of the fibroblast growth factor receptors (FGFR) 1-3 and receptor tyrosine kinases including epidermal growth factor receptor (EGFR), platelet-derived growth factor receptor (PDGFR), and c-kit. Inhibiting these receptors can lead to tumor regression by blocking their signaling pathways. Infigratinib has been shown to be well tolerated in clinical trials and summarizes the effects of this drug on tumors as "rapidly progressive disease" or "progressive disease with few symptoms".</p>Formula:C26H34Cl2N7O7PPurity:Min. 95%Molecular weight:658.47 g/molCD4 antibody (FITC)
<p>Mouse monoclonal CD4 antibody (FITC); human immunogen; IgG1 kappa; clone RPA-T4</p>Transferrin antibody (Texas Red)
<p>Transferrin antibody (Texas Red) was raised in rabbit using human transferrin as the immunogen.</p>MDM4 antibody
<p>MDM4 antibody was raised in rabbit using the N terminal of MDM4 as the immunogen</p>Ep4 receptor antagonist 1
CAS:<p>Please enquire for more information about Ep4 receptor antagonist 1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H21F3N4O3Purity:Min. 95%Molecular weight:458.4 g/mol
