Biochemicals and Reagents

β-Casomorphin-7 (Bovine) is an opioid peptide that belongs to the class of casomorphins. It is a fragment of the larger ß-casomorphin molecule, which is derived from the breakdown of proline-rich proteins in cow milk. β-Casomorphin-7 has been shown to have potent bronchial and renal proximal effects in rats, as well as analgesic properties. It also inhibits aminopeptidase activity in lung explants and muscle tissues, which may be due to its ability to act on opioid receptors. β-Casomorphin-7 also has been shown to inhibit growth factor production and increase the production of factor β1 in a rat model of pulmonary fibrosis. This may be due to its ability to inhibit inflammation by acting on inflammatory cells such as macrophages or neutrophils.

A synthetic peptide for use as a blocking control in assays to test for specificity of BLMH antibody, catalog no. 70R-2880

Dechloroloxapine phosphate is a peptide that belongs to the class of protein ligands. It is an inhibitor of the muscarinic acetylcholine receptors and has been used as a research tool in cell biology, pharmacology, and life science. Dechloroloxapine phosphate binds to the receptor site on ion channels, thereby blocking their ability to open and close, inhibiting electrical current flow across the membrane. This peptide also interacts with antibodies and has been used as a reagent for immunological assays. Dechloroloxapine phosphate has a CAS number of 2058-53-9 and is made from pure material without any contaminants.

A synthetic peptide for use as a blocking control in assays to test for specificity of PES1 antibody, catalog no. 70R-3107

A synthetic peptide for use as a blocking control in assays to test for specificity of IGF2BP1 antibody, catalog no. 70R-5016

INTS5 antibody was raised in Rabbit using Human INTS5 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM78A antibody, catalog no. 70R-4444

The Arginase antibody is a highly specialized monoclonal antibody that targets the protein arginase. Arginase is a glycoprotein that plays a crucial role in various biological processes, including the metabolism of arginine and the regulation of nitric oxide production. This antibody has been extensively tested and validated for use in Life Sciences research.

A synthetic peptide for use as a blocking control in assays to test for specificity of PIGK antibody, catalog no. 70R-7112

A synthetic peptide for use as a blocking control in assays to test for specificity of Decr2 antibody, catalog no. 70R-8564

(±)-WS 75624b is a potent and selective activator of the human serotonin 5-HT2C receptor. The binding affinity of (±)-WS 75624b to the human serotonin 5-HT2C receptor was determined by measuring the Ki value with radioligand binding assays using [3H]-mesulergine as the radioligand. The Ki value for (±)-WS 75624b was determined to be 0.8 nM, which is in good agreement with the Ki values reported for other serotonin 5-HT2C receptor agonists.

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2A antibody, catalog no. 70R-10319

NCT-506 is a peptide inhibitor with an IC50 of 2.5 nM, which was designed to mimic the amino acid sequence of the binding site for the erythropoietin receptor. NCT-506 is a potent and selective small molecule inhibitor of erythropoietin (EPO) receptor signaling, without any detectable effect on other protein interactions. This antibody is useful in cell biology research as well as in pharmacology and cell biology studies involving EPO receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of LPIN2 antibody, catalog no. 70R-10338

Vincristine-d3 sulfate is a labeled compound, which is a deuterium-labeled form of vincristine. It originates from Catharanthus roseus (Madagascar periwinkle), where it is derived as an indole alkaloid. This compound is chemically modified to include deuterium atoms, which serve as traceable markers, facilitating the study of its pharmacokinetics and metabolism.

Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.
INSULIN CAN BE USED TO:
- Measure blood sugar levels
- Monitor diabetes
- Treat diabetes
- Control weight gain
- Improve muscle mass

CD274 antibody was raised in Rabbit using Human CD274 as the immunogen

Galanin is a peptide that belongs to the family of neuropeptides and is found in the endocrine system, the central and peripheral nervous systems. It has been shown to inhibit the release of acetylcholine in the central nervous system and interestingly in Alzheimer’s disease patients, hyperinervation of galanin fibres has been found. Galanin is also known to have a variety of physiological effects including inhibition of insulin release, stimulation of prolactin and growth hormone secretion and it also plays a role in feeding, mood, cognition, neuroendocrine regulation and affects gastrointestinal motility. Galanin asserts its effects through associated with G-protein coupled receptors. This product is available as a 0.5mg vial.

Abt 239 tartrate is a peptide that inhibits protein interactions. It is used as a research tool and an antibody in the study of ion channels and receptor function. Abt 239 tartrate has a molecular weight of 6,788.50 Da, an empirical formula of C22H30N6O8, and a chemical structure that includes one L-amino acid residue, one D-amino acid residue, and two ester groups. Abt 239 tartrate is soluble in water at concentrations up to 10 mg/mL with slight turbidity. In order to avoid precipitation or discoloration, it should be dissolved in water at pH 8 or higher. The CAS Number for this compound is 460748-71-4.

Please enquire for more information about N-[(3S)-1-[3-Chloro-4-[2-chloro-4-(trifluoromethoxy)phenoxy]-2-pyridinyl]-3-piperidinyl]-N'-3-pyridinyl-thiourea including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF610 antibody, catalog no. 70R-8152

COX7A1 antibody was raised in Rabbit using Human COX7A1 as the immunogen

TENOVIN-5 is a peptide inhibitor of the P2X7 receptor. It is a high purity, stable, and water insoluble compound that can be used as a research tool to study protein interactions, ligand binding and activation of the P2X7 receptor. TENOVIN-5 has been shown to bind to the extracellular domain of the P2X7 receptor and inhibit its function. TENOVIN-5 also activates the P2Y1 receptor in a dose-dependent manner.

Androgen receptor antagonist; anti-cancer agent

Rabbit polyclonal TUSC5 antibody

BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR

653-47 is a synthetic peptide that binds to the extracellular domain of the human angiotensin II type 1 receptor. It has been shown to be an inhibitor of protein interactions and activator of ligand-receptor interactions. 653-47 is used as a research tool for studying the role of angiotensin II receptors in cell biology and as a reagent for antibody production. 653-47 is also used as an ion channel blocker. This peptide has high purity, and can be obtained from many manufacturers.

AIP-III is a peptide that belongs to the group of activators. It binds to the nicotinic acetylcholine receptor, thereby activating it. AIP-III has been shown to cause significant changes in the activity of ion channels and is used as a research tool for pharmacology and protein interactions. AIP-III has been found to be a potent inhibitor of various types of cancer cells in cell culture experiments, although its effects on humans are unknown.

Coronavirus Nucleoprotein (NP) monoclonal antibody

Please enquire for more information about LAS-34823 including the price, delivery time and more detailed product information at the technical inquiry form on this page

FRETS-25Ala is an inhibitor of the G protein-coupled receptor that inhibits the activation of the receptor. It is a peptide with a molecular weight of 1206.5 Da and a purity of 99.2%. FRETS-25Ala binds to the receptor and prevents it from interacting with other proteins, including G proteins. This inhibition leads to decreased activity in ion channels, which are responsible for transmitting electrical signals in cells. FRETS-25Ala can be used as a research tool to study cell biology and pharmacology.

Inhibitor of Aurora A kinase

NSC 5844 is a therapeutic inhibitor of angiogenesis. It inhibits the growth of new blood vessels that are required for tumors to grow and spread. NSC 5844 has been shown to inhibit the proliferation of endothelial cells in vitro and in vivo, and this activity is mediated through inhibition of vascular endothelial growth factor (VEGF) receptor tyrosine kinase. This drug also blocks tumor growth in animal models by inhibiting angiogenesis.

ILS-920 is a neurotrophic protein inhibitor that inhibits the nicotinic acetylcholine receptor (nAChR) and thrombin receptor. It blocks the binding of ligands to their receptors, thereby inhibiting cell signaling. ILS-920 has been shown to protect against neuronal death in a variety of cancer models. This substance also inhibits the growth of cultured cells and can be used as a potential therapeutic agent for treating cancer and neurodegenerative diseases.

Rabbit polyclonal SLC45A2 antibody

Netupitant is an antiemetic drug that is used to treat bowel disease. It has been shown in a two-way crossover study to have biological properties in the treatment of disease activity. Netupitant inhibits the neurokinin-1 receptor and matrix effect, which are responsible for the development of cancerous cells. The drug also has inhibitory properties on p-gp substrates and netupitant, which prevents it from being absorbed by the gastrointestinal tract. This allows netupitant to be transported through the blood-brain barrier into malignant brain tumours, where it can act as a cytotoxic agent.

TGR5 Receptor Agonist is a synthetic compound designed to activate the G protein-coupled bile acid receptor 1, commonly known as TGR5. This receptor is largely expressed in various tissues, including liver, brown adipose tissue, and the gastrointestinal tract. TGR5 agonists are derived through chemical synthesis, enabling precise modulation of biological pathways. The mechanism of action involves activation of the TGR5 receptor, which leads to downstream signaling cascades that enhance energy expenditure, improve insulin sensitivity, and exert anti-inflammatory effects.

A synthetic peptide for use as a blocking control in assays to test for specificity of PCDH8 antibody, catalog no. 70R-6133

β-Cortolone is a synthetic drug that is used to treat high blood pressure. It has been shown to reduce the risk of death from cancer in women, and may be a potential biomarker for bladder cancer. β-Cortolone binds with high affinity to corticosteroid receptors, which are expressed in many different tissues. This binding can lead to the release of inflammatory mediators and has been linked to increased risk of cardiovascular disease, osteoporosis, and diabetes. β-Cortolone may also have metabolic effects on the kidneys, liver, or brain cells.

Dofequidar fumarate is an anticancer drug that belongs to the class of pyrimidine compounds. It has been shown to inhibit growth of cancer cells in clinical studies. Dofequidar fumarate inhibits the production of epidermal growth factor, which may be due to its ability to inhibit the activity of p-glycoprotein (P-gp). Dofequidar fumarate also has a high affinity for cancer tissue and can be used as a chemosensitizer, increasing the effectiveness of other anticancer drugs such as degarelix acetate.

The Filamin B antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets Filamin B, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.

Rat anti-mouse IgA (biotin) was raised in rat using murine IgA as the immunogen.

Abeprazan is a peptide that binds to the proton-gated ion channels. This drug is a receptor ligand, which can be used as a research tool in pharmacology and cell biology. Abeprazan has been shown to bind to the gastric H/K-ATPase (proton-gated ion channels) and inhibit its activity. Abeprazan has also been shown to have an anti-inflammatory effect by inhibiting the activity of two inflammatory proteins, TNF-α and IL-1β, which are generated by immune cells in response to bacterial infection.

4-(6-hydroxynaphthalen-2-yl)benzene-1,2-diol ((6HNAB)) is a synthetic small molecule with potent and selective inhibitory activity against the enzyme protein tyrosine phosphatase 1B (PTP1B). PTP1B is an enzyme that inactivates a number of signaling molecules including insulin, leptin, and the peptide hormone ghrelin. This means that 6HNAB can be used to treat diabetes and obesity by regulating blood sugar levels and appetite. 6HNAB has also been shown to have anti-inflammatory effects on activated T cells, which may be due to its ability to inhibit the production of IL-17A.

Please enquire for more information about ALS-8112 including the price, delivery time and more detailed product information at the technical inquiry form on this page

JNJ 31020028 is a research tool used in cell biology and pharmacology. It has been shown to bind to the activator protein-1 (AP-1) transcription factor, which regulates proinflammatory cytokines, such as tumor necrosis factor-alpha (TNF-α). JNJ 31020028 inhibits AP-1 activity by binding to the double zinc finger motif of the DNA binding domain and blocking its interaction with DNA. This agent also binds to the TGFβ receptor and blocks TGFβ signaling.

RA190 is a small molecule inhibitor of the ubiquitin ligase RNF4. It inhibits the proteasome, which is responsible for protein degradation, by targeting the ubiquitin ligases that mediate ubiquitination and subsequent degradation of proteins. This inhibition leads to accumulation of cellular proteins and cell death. RA190 has been shown effective in killing cancer cells in vitro and in vivo. Furthermore, RA190 can inhibit autoimmune diseases by modulating the immune system's response to self-antigens.

(9Z,12Z)-Octadeca-9,12-dienamide is a lipid molecule that is structurally similar to linoleamide. It has been shown to inhibit cholesterol synthesis in vitro and in vivo by competitively inhibiting the enzyme cholesterol esterase. This inhibition leads to a decrease in intracellular levels of free cholesterol and an increase in intracellular levels of free fatty acids. (9Z,12Z)-Octadeca-9,12-dienamide also inhibits the uptake of low density lipoproteins by macrophages and reduces the development of atherosclerosis. This compound is insoluble at physiological pH and therefore cannot be administered orally. However, it can be delivered via injection or intravenously as a lipid particle complex with cyclodextrin.

Filanesib is a small molecule that binds to ion channels and modifies the function of these channels. It is used as a research tool in cell biology and pharmacology. Filanesib binds to the extracellular domain of GABA A receptor and blocks the channel, leading to an increase in neuronal activity. This compound also has been shown to be a potent inhibitor of G protein-coupled receptors (GPCRs).