Biochemicals and Reagents

(+)-BAY-1251152 is a small molecule drug that has been shown to inhibit the growth of malignant brain tumors. It binds to microenvironmental niches in the brain, which may be responsible for the resistance of these cells to conventional treatments. The mechanism of action of (+)-BAY-1251152 is thought to be due to its epigenetic effects, which can lead to changes in gene expression. This drug has been shown to reduce the size of malignant brain tumors and increase survival rates in mice with malignant brain cancer. (+)-BAY-1251152 is also being evaluated as a potential treatment for other cancers such as lung cancer, breast cancer, and ovarian cancer.

Activator/ stimulator of interferon genes (STING)

Ro 22-5112 is an investigational pharmaceutical compound primarily characterized as an adrenergic receptor modulator. It is synthetically derived and designed to interact with specific adrenergic receptors within the human body. The mode of action of Ro 22-5112 involves binding to these receptors, leading to the modulation of adrenergic signaling pathways. This interaction can influence various physiological responses such as heart rate, vascular resistance, and neurotransmitter release.

Purified recombinant Human PYCRL protein (His tag)

Centromere protein B (CENP-B) is a protein that belongs to the histone H3 family. It is one of the proteins involved in regulating chromosome segregation during mitosis and meiosis. CENP-B has been shown to be involved in the activation of kinetochores, which are structures on the surface of chromosomes that attach to microtubules and help with mitotic chromosome movement. Centromere protein B can also be used as a ligand or receptor, or a tool for cell biology, immunology, and pharmacology research.

AVE3085 is a novel drug that inhibits the activity of soluble guanylate cyclase. It has been shown to have a positive effect on cardiac hypertrophy and chronic kidney disease (CKD) by inhibiting the production of reactive oxygen species by pde5 inhibitors and organic nitrates. This drug also has an effect on blood pressure in clinical studies, which may be due to its inhibition of polymerase chain reaction. AVE3085 is currently undergoing phase III clinical trials.

A synthetic peptide for use as a blocking control in assays to test for specificity of TUBE1 antibody, catalog no. 70R-5639

HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET

A synthetic peptide for use as a blocking control in assays to test for specificity of SH2D1A antibody, catalog no. 70R-10049

2-((1S)-1-[[2-Amino-9H-purin-6-yl]amino]ethyl)-5-methyl-3-(2-methylphenyl)-4(3H)quinazolinone is a synthetic, high purity, potent and selective agonist at the δ subtype of the GABAA receptor. It has been shown to inhibit calcium influx in cells with no effect on chloride influx.

A synthetic peptide for use as a blocking control in assays to test for specificity of CD55 antibody, catalog no. 70R-10001

Prostaglandin E2 receptor antagonist

Mouse monoclonal PRMT2 antibody

NS1652 is a new drug that has been shown to have high potential for interactions with other drugs. It is a cationic amino acid that binds to the red cell membrane and alters transport properties of the cell. NS1652 has been shown to inhibit uptake of the amino acid L-lysine by cells. It also inhibits transfection experiments in vitro, which may be due to its ability to interfere with cellular physiology.
NS1652 is a high-resistance, non-selective cation channel blocker that has been shown to have chemical structures similar to those found in common drugs such as ibuprofen, naproxen, indomethacin, and diclofenac. These similarities suggest that it could cause adverse effects when taken with these medications because there would be an increased risk of interaction between the two drugs.

Rabbit polyclonal KCNC1 antibody (Ser503)

Ibrutinib d5 is a potent and selective inhibitor of Bruton's tyrosine kinase (BTK). BTK is a non-receptor protein tyrosine kinase that plays an important role in the B-cell receptor signaling pathway. Ibrutinib d5 binds to BTK, and blocks its ATP binding site, preventing it from phosphorylating other proteins. This inhibition reduces the phosphorylation of key downstream effectors, such as ZAP-70, which is involved in B-cell proliferation and activation. Ibrutinib d5 also inhibits activation of PI3K/Akt signaling pathways and suppresses cytokine production.

The CD40 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used in various immunoassays to detect the presence of CD40, a protein that is involved in immune responses. This antibody specifically targets CD40 and binds to it, allowing for accurate detection and quantification. The CD40 antibody has been extensively studied and proven to be highly effective in detecting CD40 in human serum samples. Additionally, it has shown promising results in inhibiting the activity of specific enzymes, such as phosphatases and fatty acids, which are involved in various cellular processes. Furthermore, this antibody has demonstrated antiviral properties by interfering with viral replication and inhibiting the growth of viruses. Overall, the CD40 antibody is a valuable tool for researchers and scientists working in the field of immunology and virology.

Rabbit polyclonal IL13 antibody (biotin)

ApoC-I protein is a catalase enzyme that plays a crucial role in various biological processes. It exhibits catalase activity, which helps in the breakdown of hydrogen peroxide into water and oxygen. Additionally, ApoC-I protein has been found to have neutralizing effects on antiphospholipid antibodies, making it a potential therapeutic target for autoimmune disorders. This protein can also be used as a peptide agent for research purposes, as it has been shown to react with specific monoclonal antibodies. Furthermore, ApoC-I protein acts as a growth factor and is involved in regulating cell growth and development. Its glycoprotein nature makes it an essential component in various Life Sciences applications. Streptavidin can be used to detect and bind ApoC-I protein due to its high affinity for biotinylated molecules. With its multifunctional properties, ApoC-I protein is a valuable tool in Proteins and Antigens research.

Recombinant human G3BP2 protein (His tag)

CGP 60474 is a neurotrophic factor that has been shown to be beneficial for the treatment of inflammatory bowel disease. It binds to intracellular targets, such as kinases, and prevents them from being activated by other molecules. CGP 60474 has also been used in diagnosis of autoimmune diseases and HIV infection. CGP 60474 is a combination preparation with an inhibitor of viral replication that is active against HIV-1, HIV-2, and SIV. The drug inhibits viral replication by binding to the viral envelope protein gp120 and preventing it from binding to the host CD4 receptor on T cells. This prevents viral entry into the cell and subsequent integration into the host genome.

Dopamine (D2) receptor antagonist; antipsychotic agent

The PNMT antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of norepinephrine, a neurotransmitter involved in various physiological processes.

CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.

Mouse monoclonal BDH2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PHACTR1 antibody, catalog no. 70R-4246

Kushenol B is a ligand that activates the G protein-coupled receptor. Kushenol B has been shown to have activity in cell biology, pharmacology and life science research. Kushenol B is a high-purity compound that can be used as an inhibitor in the study of protein interactions with other proteins and peptides. Kushenol B also has been shown to inhibit ion channels, which may lead to potential therapeutic applications for epilepsy and other disorders.

Calpain 10 antibody was raised using the N terminal of CAPN10 corresponding to a region with amino acids MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEIC

Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mavorixafor is an antagonist that binds to the chemokine receptor CXCR4. It is used as a research tool for studying CXCR4-mediated signaling and protein interactions. Mavorixafor also has pharmacological activity, which may be due to its ability to activate G protein-coupled receptors and ion channels. Mavorixafor trihydrochloride is a highly purified drug that is soluble in water. It has a molecular weight of 576.8 Da and the chemical formula CHClNOS. CAS No: 2309699-17-8

Region of TSG protein corresponding to amino acids MCNKALCASD VSKCLIQELC QCRPGEGNCS CCKECMLCLG ALWDECCDCV GMCNPRNYSD TPPTSKSTVE ELHEPIPSLF RALTEGDTQL NWNIVSFPVA EELSHHENLV SFLETVNQPH HQNVSVPSNN VHAPYSSDKE HMCTVVYFDD CMSIHQCKIS CESMGASKYR WFHNACCECI GPECIDYGSK TVKCMNCMF.

Mating factor α trifluoroacetate is a research tool with CAS No. 59401-28-4 that is used in Cell Biology, Pharmacology, and Ion channels. Mating factor α trifluoroacetate inhibits ligand binding to receptor by competing with the natural substrate for the active site. It has been shown to be an activator of ion channels, which allow ions to flow through the cell membrane. Mating factor α trifluoroacetate can also be used as a research tool in antibody production and protein interactions.

Rabbit polyclonal CKMT antibody (biotin)

5-[(1,1-Dioxo-1,4-thiazinan-4-yl)methyl]-N-(1-methylsulfonylpiperidin-4-yl)-2-phenyl-1Hindol-7a(2H)-one is a potent and selective inhibitor of voltage gated sodium channels. It has been shown to inhibit the activity of recombinant human Na v 1.4 channels in a reversible fashion with an IC 50 value of 0.14 μM.

Pdk4-in-1 hydrochloride is a peptide that has been shown to activate the erythropoietin receptor. It is an inhibitor of protein interactions and can be used as a research tool for studying the effects of peptides on ion channels, cell biology, and pharmacology. Pdk4-in-1 hydrochloride has also been shown to inhibit the activity of various receptors, including the erythropoietin receptor (EPOR) and lysophosphatidic acid receptors. This peptide can be used as a ligand to investigate the interactions between proteins in cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC16 antibody, catalog no. 70R-6344

CUL4B antibody was raised in Rabbit using Human CUL4B as the immunogen

LACTB2 antibody was raised in Rabbit using Human LACTB2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PPME1 antibody, catalog no. 70R-3709

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP5H antibody, catalog no. 70R-9149

CAPN1 antibody was raised in rabbit using the N terminal of CAPN1 as the immunogen

Rabbit polyclonal USP3 antibody

Rabbit polyclonal OR8S1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SUSD4 antibody, catalog no. 70R-6884

CYP2E1 antibody was raised in rabbit using a synthetic peptide as the immunogen.

Recombinant Human VEGF165 protein