Biochemicals and Reagents

<p>H-SIFVVKGDLPDCEADQLLQM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SIFVVKGDLPDCEADQLLQM-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SIFVVKGDLPDCEADQLLQM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SIFVVKGDLPDCEADQLLQM-OH at the technical inquiry form on this page</p>

<p>GPRC5B</p>

<p>Mastoparan is a 14-residue cationic peptide toxin isolated from the wasp Vespula lewisii venom which shows an important potency as an antimicrobial and anticancer agent but also as a Cell Permeable Peptide.<br>Mastoparan is mainly known to be a receptor-independant and allosteric regulator of G-protein by stimulating GTPase activity.<br>Besides modulating the activity of G-protein, Mastoparan have the ability to bind other intracellular targets such as Ca2+-ATP (implicated in Ca2+ release), small GTP binding proteins rho and rac, and many others.<br>Mastoparan also belongs to the cell permeable peptide (CPP) family. As such, Mastoparan increases the membrane conductance and permeability of planar lipid bilayer and liposomal membranes which leads to enhanced the penetration of Ca2+, Na+ or K+ ions.<br>Mastoparan have also a potential antibiotic effect due to its potent antimicrobial activity which can turn Mastoparan to a potential drug for infectious diseases.<br>Some studies have also reported that Mastoparan exhibits potent anti-cancer activities toward leukemia, myeloma, and breast cancer cells with an approximately half maximal inhibitory concentration (IC50) of 9µM, 11µM and 22µM respectively.<br>Mastoparan have shown to be more specific to cancer cells than to normal cells.</p>

<p>Prostaglandin D2 receptor antagonist</p>

<p>Peptide H-DAAQK^TDTSHHDQDHPTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>1-387 amino acids: MKIEEGKLVI WINGDKGYNG LAEVGKKFEK DTGIKVTVEH PDKLEEKFPQ VAATGDGPDI IFWAHDRFGG YAQSGLLAEI TPDKAFQDKL YPFTWDAVRY NGKLIAYPIA VEALSLIYNK DLLPNPPKTW EEIPALDKEL KAKGKSALMF NLQEPYFTWP LIAADGGYAF KYENGKYDIK DVGVDNAGAK AGLTFLVDLI KNKHMNADTD YSIAEAAFNK GETAMTINGP WAWSNIDTSK VNYGVTVLPT FKGQPSKPFV GVLSAGINAA SPNKELAKEF LENYLLTDEG LEAVNKDKPL GAVALKSYEE ELAKDPRIAA TMENAQKGEI MPNIPQMSAF WYAVRTAVIN AASGRQTVDE ALKDAQTNSS SNNNNNNNNN NLGIEGR</p>

<p>The THC antibody is a highly specialized monoclonal antibody designed for the detection of delta-9-tetrahydrocannabinol (THC). It is a macromolecular structure that utilizes single-walled carbon nanotubes to enhance its binding capabilities. This antibody is widely used in the field of Life Sciences, particularly in immunoassays and antigen-antibody reactions.</p>

<p>H-SASTNPNAM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SASTNPNAM-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SASTNPNAM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SASTNPNAM-OH at the technical inquiry form on this page</p>

<p>Anti-SCN9A/Nav1.7 antibody</p>

<p>YSA binds to the extracellular domain of ephrin type-A receptor 2 (EphA2) with high affinity and selectivity. YSA binding activates EphA2 and its tumour suppressing downstream signalling pathways (including inhibition of the PI3K/Akt and ERK pathways), and promotes receptor internalisation.EphA2 is highly expressed in many types of solid tumour, and the level of EphA2 expression is positively correlated with malignancy and poor prognosis in some cancer types.YSA has been shown to be an effective targeting peptide of chemotherapeutic drugs to EphA2 expressing tumours. YSA-drug conjugates are able to selectively target EphA2 expressing tumours, both activating tumour supressing downstream signalling pathways, and becoming effectively internalised by cancer cells to further increase the potency of the chemotherapeutic drug. YSA-drug conjugates have been shown to be dramatically more effective at inhibiting tumour growth than chemotherapy alone. Selective tumour targeting with YSA could also reduce the systemic toxicity caused by nonselective and highly toxic chemotherapy agents, and thus reduce adverse side effects of chemotherapy.The uncharged C-terminal amide has the potential to increase the biological activity of this peptide.</p>

<p>Purified Rubeola virus protein</p>

<p>ÎŽ opioid receptor agonist; anti-nociceptive; anti-depressant</p>

<p>PD-1 (27-41) peptide is derived from the programmed cell death-1 (PD-1) which interacts with its ligand, PD-L1 to regulate immune homeostasis. PD-1 and its ligand PD-L1 are critical in regulating T cell activation, tolerance and immuno-pathology. PD-1 is an immune checkpoint and guards against autoimmunity through two mechanisms. First, it promotes apoptosis of antigen-specific T-cells in lymph nodes. Second, it reduces apoptosis in regulatory T cells.Several types of cancer cells overexpress PD-L1 in order to escape from the PD-1/PD-L1 immuno-surveillance mechanism. Consequently PD-1 inhibitors and PD-L1 inhibitors could be used as a therapeutic in the treatment of cancers.</p>

<p>Peptide H-QQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Extracellular signal-regulated kinase 1/2 (ERK1/2) is a mitogen-activated protein kinase (MAPK) family protein and part of the Ras-Raf-MEK-ERK signalling pathway which plays a key role in controlling cell proliferation, differentiation and cell survival. ERK1/2 acts downstream of activated growth factor receptors, RAF protein kinases and mitogen-activated protein kinase kinases 1 and 2 (MEK1/2). MEK1 and MEK2 activate ERK1/2 by phosphorylation and once activated ERK1/2 enters the nucleus and phosphorylates transcription factors to induce changes in gene expression. In addition to this active ERK1/2 also translocates to other organelles including the endoplasmic reticulum, endosomes, golgi and mitochondria where it influences cell physiology. Overall ERK1/2 phosphorylates more than 200 different substrates including other protein kinases, transcription factors, RNA-binding proteins, regulators of mRNA translation and regulators of cell death. ERK1/2 pathway is strongly implicated in cancer where its hyperactivation underpins the growth and maintenance of many tumour types._x000D_<br>_x000D_<br>This antibody is conjugated to Alexa Fluor® 488. Alexa Fluor® 488 is a popular bright green fluorescent dye with high pH-stability.</p>

<p>GPRC5B</p>

<p>The Histone H3 (20-36)-K27Me3 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter to change the positioning of the nucleosome, allowing the DNA it to be either available to the transcription machinery or inaccessible.The Histone H3 (20-36) lysine 27 has been trimethylated which is usually a marker of repressive chromatin. H3K27 trimethylation also prevents H3 from interacting with SET1-like complexes, thus inhibiting the trimethylation of H3K4.</p>

<p>Peptide H-GAHWQFNAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Timely chromosome segregation during mitosis and meiosis is orchestrated by separase activity cleaving the multi-subunit cohesin complex from the centromere. Sister chromosomes remain attached at the centromere till after meiosis I anaphase due to shugoshins protecting cohesin from separase activity. Recent work shows shugoshin's role is to interact with PP2A and maintaining cohesin in a dephosphorylated state thus protecting the centromeric RecB protein from separase activity.<br>In mammals, there are 2 known sugoshins paralogues, Sgo1 and Sgo2. Sgo1 appears to play the primary role in cohesin protection during mitosis when most cohesin complex dissociates from the chromosome arms. Whereas Sgo2 aids centromeric cohesion during meiosis. Reduced levels of Sgo1 have been associated with colorectal cancers due to the increased chromosomal instability leading to tumourigenesis. Defective Sgo1 has also been linked to aneuploidy. This KLH conjugated Sgo1 antibody is the ideal research tool to investigate the functions of shugoshins as there is still much to uncover.</p>

<p>SV40 T antigen antibody was raised in mouse using the N-terminal domain of SV40 large and small T-antigen as the immunogen.</p>

<p>Peptide Protein Kinase A Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>C20 Ceramide (d17:1/20:0) is a sphingolipid analog, specifically synthesized for laboratory research. It is a ceramide, a type of lipid molecule found in cell membranes, derived from a synthetic source to facilitate targeted scientific inquiries. The mode of action involves its incorporation into cell membranes, mimicking endogenous ceramides to alter and study cellular signaling pathways, particularly those related to apoptosis, cell growth, and differentiation.</p>

<p>Benidipine is a synthetic dihydropyridine calcium channel blocker. This drug is used in the treatment of coronary heart diseases, hypertension, and angina pectoris. Benipidine binds to the L-type voltage-gated calcium channels and blocks their opening which leads to smooth muscle relaxation and a decrease in blood pressure.</p>

<p>Peptide Ac-CPLSAYKRGYLYQTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>IL11 antibody was raised in Mouse using recombinant human IL-11 as the immunogen.</p>

<p>Parvovirus antibody was raised in mouse using canine parvovirus as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Peptide H-VLTEIIASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Nuclear lamin proteins (lamin A, B and C) form a complex structural scaffold, called the nuclear lamina, which is associated with the inside of the nuclear envelope. Lamins bind to a huge number of nuclear protein complexes and are involved in several processes, including chromatin organisation, gene regulation, genome stability, nuclear and cytoskeletal organisation, mechanical stability, differentiation, and tissue-specific functions. Mutations in lamin proteins result in laminopathies such as muscular dystrophy and the accelerated aging condition, Hutchinson-Gilford progeria. This antibody recognises human lamin A and C in both Western blots and immunohistochemistry with a strong signal and low background noise, and has an AF488 dye conjugated to it. AF488 is a popular, bright green, PH-stable fluorescent dye.</p>

<p>Please enquire for more information about Nucleosome Antigen, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The pluripotency-associated master transcriptional regulator SOX2 is essential during mammalian embryogenesis, embryonic stem cell maintenance and later in life, however SOX2 expression can also be highly detrimental. SOX2 has been shown to be expressed in at least 25 different cancers, consequently, too little or too much SOX2 can dramatically alter tumour growth. SOX2 is therefore tightly regulated at the transcriptional level, by microRNAs, long non-coding RNAs, and post-translational modifications.</p>

<p>Purified recombinant Treponema pallidum p17 protein (beta Galactosidase Fusion)</p>

<p>Fmoc-His(Trt)-Wang Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis that contains Fmoc-His(Trt) and 1% DVB. It is used to synthesize peptides with Fmoc chemistry.</p>

<p>ROBO2</p>

<p>BMP7 is a protein that belongs to the TGF-β superfamily. It is a potent inhibitor of bone resorption in vitro and in vivo. BMP7 also has been shown to inhibit the synthesis of collagenase and other proteases by osteoclasts, leading to decreased bone resorption. This protein activates receptors for insulin-like growth factor and activin, which are proteins produced by bone cells (osteoblasts) that regulate bone formation. BMP7 can also be used as a research tool for studying receptor activation, ligand binding, or ion channel function.</p>

<p>Goat anti-mouse IgM (PE) (mu chain specific) was raised in goat using murine IgM, Mu-chain as the immunogen.</p>

<p>Diflunisal is a nonsteroidal anti-inflammatory drug (NSAID), which is a synthetic derivative of salicylic acid. It is primarily sourced through chemical synthesis rather than extraction from natural elements. Diflunisal functions by inhibiting the cyclooxygenase (COX) enzymes, specifically COX-1 and COX-2, which play a crucial role in the biosynthesis of prostaglandins. This inhibition results in reduced production of prostaglandins, compounds involved in inflammation and pain signaling pathways.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Peptide H-SLLQHLIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The SARS coronavirus E protein is a recombinant protein that acts as a binding protein. It plays a crucial role in the growth and development of various factors, including epidermal growth factor, hepatocyte growth factor, and endothelial growth factor. This protein can be used in research and diagnostic applications to study the interactions between different proteins and their effects on cellular processes. Additionally, it can be used as a target for monoclonal antibodies or inhibitors to neutralize its activity. The SARS coronavirus E protein is a valuable tool for understanding the mechanisms of viral infection and developing therapeutic interventions.</p>

<p>H-LLWTLVVLL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLWTLVVLL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLWTLVVLL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLWTLVVLL-OH at the technical inquiry form on this page</p>

<p>Tandospirone is a psychotropic drug that acts as a selective serotonin receptor partial agonist. It is derived from a synthetic source, specifically targeting the 5-HT1A receptors in the brain. Tandospirone modulates serotonergic neurotransmission by binding to these receptors, which are associated with mood regulation. This action results in the anxiolytic and antidepressant effects observed with the drug.</p>

<p>H-SSRWRFPARPGT-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SSRWRFPARPGT-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SSRWRFPARPGT-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SSRWRFPARPGT-NH2 at the technical inquiry form on this page</p>

<p>The SLC12 family consists of nine member proteins, SLCA1 through to SLC12A9. Solute Carrier Family 12 Member 2 (SLC12A2) encodes a protein used in mediating the cotransport and reabsorption of Na+, K+ and 2Cl- ions (NKCC), it is a membrane-bound symporter channel needed for both epithelial absorption and secretion of ions. SLC12A2 spans the membrane and is necessary in maintaining ionic balance, cell volume and overall homeostasis of a cell.SLC12A2 is shown to be involved in neurodevelopment, specifically in the cortex, and is associated with neurodevelopmental disorders, with SLC12A2 mutation rate being significantly higher in individuals with neurodevelopmental issues. Additionally, mutations in SLC12A2 have been shown to cause issues with sensorineural pathways, causing hearing loss and deafness. Research into SLC12A2 and the SLC12 family as a whole could be beneficial in finding treatments for these complex neuronal issues.</p>

<p>Acyl-CoA:monoacylglycerol acyltransferase 1 (MGAT1) acylates monoacylglycerol to form diacylglycerol. MGAT activity is part of the MGAT pathway which allows the storage of neutral triacylglycerol (TAG). This is an auxillary pathway to the glycerol-3-phosphate (G-3-P) pathway. MGAT1 is highly expressed in adipocytes and may function to suppress aberrant lipolysis, which can lead to steatosis. MGAT isoforms (MGAT1, MGAT2, MGAT3) are increased in humans and mouse models of nonalcoholic fatty liver disease (NAFLD). Antisense oligonucleotides (ASO) have been used to reduce hepatic MGAT activity, which was independent of MGAT1. This improves hepatic insulin sensitivity and glucose metabolism without affecting hepatic DAG or TAG levels in obese mice models.  The TAG synthesis in steatosis associated with lipodystrophy and obesity minimally depends on MOGAT1. The study of MGAT1 aims to improve understanding of insulin resistance and steatosis and better elucidate the function of MGAT1 compared to MGAT2 and MGAT3.</p>

<p>Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Cyclin-dependent kinases (CDKs) are regulated by positive and negative phosphorylation. T14/Y15 phosphorylation by the WEE1 and MYT1 kinases inhibits CDKs by preventing ATP binding, and these conserved phosphorylations are highly regulated during the cell cycle and by signalling pathways. WEE1 and MYT1 are opposed by cell division cycle 25 (CDC25) phosphatases, which, in mammals, comprise three related enzymes that dephosphorylate T14/Y15 to promote CDK activity.</p>

<p>H-DEPLERRL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DEPLERRL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DEPLERRL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DEPLERRL-OH at the technical inquiry form on this page</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>LLO (91 - 99)</p>

<p>The HSA (55-66) peptide is derived from human serum albumin (HSA), a protein present in the blood plasma. It is involved in the transportation of compounds through the blood stream, the maintenance of osmotic blood pressure and could be used to improve drug delivery.</p>

<p>N-methyl-D-aspartate receptors (NMDARs) are ligand-gated ionotropic glutamate receptors that mediate excitatory synaptic transmission and are important for many aspects of nervous system function including: synaptic plasticity; learning and memory; neuronal development and circuit formation. NMDARs have also been implicated in various neuronal disorders. NMDARs are heteromers consisting of an obligate NR1 and most commonly one or two kinds of NR2 subunits or occasionally NR3 subunits.</p>

<p>NGF</p>

<p>Peptide H-KSAYMRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified recombinant Pru P 1 protein</p>

<p>Peptide H-IVASTLSNPELFEEWTGNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified recombinant Mouse LYVE1 protein</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Iproniazid is an irreversible monoamine oxidase inhibitor of the hydrazine class. It was initially used for the treatment of tuberculosis however now it is used for the treatment of depression. Iproniazid inhibits the activity of monoamine oxidases (MAOs) by itself and through an active metabolite, isopropylhydrazine. Additionally, it prevents the enzymatic breakdown of norepinephrine.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Histone H3 (32-38) K36Me2 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter to change the positioning of the nucleosome, allowing the DNA it to be either available to the transcription machinery or inaccessible.The Histone H3 (32-38) lysine 36 has been dimethylated.</p>

<p>Peptide H-YSTDVSVDEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat anti-monkey IgG (Rhodamine) was raised in goat using monkey IgG gamma chain as the immunogen.</p>

<p>Peptide H-IPNAGTDPNSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>APP antibody was raised in goat using a synthetic peptide corresponding to amino acid residues 44-63 of the N-terminus of the human alzheimer’s APP as the immunogen.</p>

<p>Peptide H-VTAQELDYLTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HBsAg antibody is a monoclonal antibody that specifically targets the hepatitis B surface antigen (HBsAg). This antibody is highly activated and has been shown to effectively neutralize HBsAg, preventing its interaction with host cells. It has also demonstrated inhibitory effects on the growth of cancer cells, such as MCF-7 breast cancer cells. In addition, this antibody has potential applications in autoimmune diseases, as it can bind to autoantibodies and inhibit their activity. The HBsAg antibody can be used as a research tool in various life science disciplines, including immunology and virology. It can also be utilized in diagnostic assays for the detection of HBsAg or as a therapeutic agent for targeted delivery of active agents. With its high specificity and binding affinity, this monoclonal antibody holds great promise in advancing scientific understanding and medical advancements in the field of hepatitis B and beyond.</p>

<p>Influenza B antibody was developed using a Victoria strain isolate.</p>

<p>Purified recombinant Coxsackievirus B1 VP1 protein (His tag)</p>

<p>RC-3095 is a guanine nucleotide-binding protein (G protein) antagonist that inhibits the activation of Toll-like receptor 4 (TLR4). It has been shown to reduce oxidative injury and improve locomotor activity in an experimental model. RC-3095 also has anti-inflammatory effects, which may be due to its ability to inhibit the activity of matrix metalloproteinase 9, as well as its ability to modulate toll-like receptor signaling. RC-3095 also binds to polymerase chain reaction amplicons, allowing for the development of a new analytical method for screening and confirming the presence of mutations in genes associated with chronic arthritis.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Transportan is an amphipathic 27 amino acid peptide that was generated from 12 functional amino acids of galanin and 14 amino acids of mastoparan connected via a lysine residue. Transportan has been functionally characterised as a cell penetrating peptide (CPP) that does not appear to be mediated by endocytosis. All cell types tested were permeated by transportan, initially localising to the outer membrane it then travels to cytoplasmic membrane structures and eventually perfuses to the nucleoli. This CPP has been used for numerous applications and assays to great effect including indirect immunofluorescence and drug delivery.TP reveals some characteristic features of both galanin and mastoparan since it inhibits the binding of galanin to GALR-1 receptor as well as modulates the activity of G proteins due to the inhibition of GTPase activity.</p>

<p>Cinprazole is an analog of omeprazole and a proton pump inhibitor. It inhibits acid secretion by blocking the H+/K+ ATPase enzyme system. Cinprazole has been used to treat gastric ulcers, gastroesophageal reflux disease, and inflammatory diseases. Cinprazole is also used to achieve hematopoietic stem cell transplantation in patients with leukemia or lymphoma. The drug has shown efficacy in treating cerebrovascular disease by enhancing cerebral blood flow and suppressing inflammation, as well as in treating hepatitis by inhibiting the growth of cells involved in its progression. Cinprazole has also been shown to suppress follicle-stimulating hormone release from the pituitary gland, which may be due to its ability to inhibit the production of follicle-stimulating hormone subunits (FSH-β)</p>

<p>Beta-casomorphin (1-2) is a peptide that has been identified as a possible endogenous ligand for opioid receptors. It is a product of the breakdown of casomorphin, a milk protein found in dairy products such as cheese and yogurt. Beta-casomorphin (1-2) has been shown to bind to human immunodeficiency virus type 1 receptors and may play an important role in the pathogenesis of human immunodeficiency virus type 1 infection. This peptide also inhibits bacterial growth by binding to bacterial ribosomes, preventing the formation of new proteins, which leads to cell death. Beta-casomorphin (1-2) has been shown to have an inhibitory effect on blood pressure and its antihypertensive activity may be due to its ability to stimulate the release of nitric oxide from endothelial cells.</p>

<p>Toxoplasma gondii protein is a versatile and potent protein that belongs to the family of kinase inhibitors. It is commonly used in research and diagnostic applications due to its ability to elicit a specific immune response. This protein can be targeted by monoclonal antibodies, which are highly specific and can be used for various applications such as immunohistochemistry and flow cytometry. One of the key characteristics of Toxoplasma gondii protein is its nephrotoxicity, which makes it an ideal candidate for studying kidney-related diseases and conditions. Additionally, this protein has shown promising effects on mesenchymal stem cells, promoting their proliferation and differentiation. Autoantibodies against Toxoplasma gondii protein have been identified in certain autoimmune diseases, suggesting its potential role in the pathogenesis of these conditions. Furthermore, this protein has been found to induce apoptosis through the activation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) pathways</p>

<p>EGFR antibody was raised in sheep using a synthetic 20 amino acid peptide of human EGFr representing a portion of the internal domain proximal to a phosphorylation region as the immunogen.</p>

<p>GLAST/ EAAT-1 (glutamate-aspartate transporter/ excitatory amino acid transporter 1) (rodent/human nomenclature) is a sodium-dependent plasma membrane glutamate transporter expressed exclusively by astrocytes in the cerebellum and present at high densities near excitatory synapses. The cerebellum is the region of the brain essential for maintaining postural control and coordination of voluntary muscle movement. Glutamate transporters regulate glutamate receptors and limit glutamate accumulation to prevent neurotoxicity whilst ensuring accurate synaptic communication. GLAST is the major transporter expressed during development. Loss of GLAST/EAAT-1 has been linked to the pathogenesis of several disorders affecting the motor system including several subtypes of spinocerebellar ataxia (SCA); SCA1, SCA5, SCA7, episodic ataxia type 6, spinal muscular atrophy and fragile X associated tremor/ataxia syndrome. Furthermore, disrupted GLAST/EAAT-1 has been associated with schizophrenia and cerebellar dysfunction and also is linked to the pathophysiology of Alzheimer's disease, autism and other cognitive and neuropsychiatric disorders. This antibody has AF488 conjugated to it. AF488 is a popular bright green fluorescent dye with high PH-stability.</p>

<p>The Laminin antibody is a monoclonal antibody that specifically targets and binds to laminin, an essential protein found in the extracellular matrix. Laminin plays a crucial role in cell adhesion, migration, and tissue development. This antibody has been extensively tested and validated for its high specificity and sensitivity in various life science applications.</p>

<p>Peptide H-DLLLPQPDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyses peptide bonds at the C-terminal glycine of ubiquitin. The gene encoding the UCHL1 protein is specifically expressed in neurons and in cells of the diffuse neuroendocrine system. Mutations in the UCHL1 gene are often associated with Parkinson disease. Recent studies have linked UCHL1 expression and inflammation- inflammation regulates UCHL1 expression, and it is this regulatory mechanism that may be involved in the progression of Parkinson disease.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IEDGFSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Glycerolipid metabolism component</p>

<p>ANP (1-28) is derived from the atrial natriuretic peptide (ANP) which is a cardiac hormone involved in maintaining cardio-renal homeostasis. This occurs through the activation of the guanylyl cyclase-coupled receptor, resulting in the increased concentration of cyclic guanylate monophosphate. Moreover its function in the processes of anti-proliferation and anti-angiogenesis allow it to take part in cardiovascular remodelling.ANP is a member of the natriuretic peptide family and it is encoded by the NPPA gene, located on chromosome 1. Once synthesized from the 151 amino acid pre-prohormone into its biologically active form, ANP is secreted by the atrial cardiomyocytes in the circulating forms: ANP (1-98) and ANP (99-126). This synthesis process involves the signal peptide being removed from the pre-prohormone resulting in pro-ANP (1-126) which is converted into the circulating forms by the type II transmembrane serine protease Corin.</p>

<p>This sequence corresponds to the peptide bond between mammalian Lys11- (K11) linked Ub proteins- where (GG) corresponds to the C-terminus of the side chain appended Ub.Chains containing Lys11 (K11) Ub linkages are considered atypical. However they have been implicated in a range of cellular pathways. K11-Linked Ub, assembled via the ubiquitin ligase: anaphase-promoting complex/cyclosome (APC/C), regulate cell cycle progression via targeting proteins to the proteasome. K11 ubiquitin linkages are also involved in maintaining endoplasmic reticulum homeostasis and maintaining cellular protein homeostasis and have been discovered in protein aggregates found in neurodegenerative diseases, such as Alzheimer's disease and Huntington's disease.The C-terminal lysine residue of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (2), giving this peptide a mass increase of 8 compared to the unlabelled peptide.</p>

<p>Rabbit polyclonal PLCD4 antibody</p>

<p>Galanin (mouse, rat) is 29 amino acids, 1 less than human galanin. Galanin is a widely distributed neuropeptide in the central nervous, peripheral, and endocrine systems. Galanin interacts with 3 receptor subtypes, GalR1-3. These G protein-coupled receptors are inserted into the plasma membrane. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala lead to food intake in rats.Galanin has been shown to inhibit glutamate release from the hippocampus. Glutamate has an excitatory effect in the mechanisms of epileptic seizures- therefore, galanin is considered a possible anticonvulsant.  Galanin receptor agonists with anticonvulsant properties have been developed to help seizures. Galanin has also helped provide evidence of neuronal plasticity and degradation. Galanin has been used extensively for administration to animals in vivo including rats and mice to better understand its role and help treat appetite disorders.</p>

<p>Please enquire for more information about Salmonella Typhi IgG and IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-ADIYTEQVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-AFPEDRSQPGQDCRFRVTQL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AFPEDRSQPGQDCRFRVTQL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AFPEDRSQPGQDCRFRVTQL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AFPEDRSQPGQDCRFRVTQL-OH at the technical inquiry form on this page</p>

<p>ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. This active compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>P2-Hp-1935 is an antimicrobial peptide isolated from the skin secretions of the Montevideo tree frog (Hypsiboas pulchellus). P2-Hp-1935 displays activity against Gram positive and negative bacteria.</p>

<p>Please enquire for more information about pTau181 Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A reversible inhibitor of IGF-1R kinase and insulin receptor. Has anti-growth effects in mesenchymal, epithelial and hematopoietic tumor types. Synergistic with other cytotoxic, hormonal and targeted anti-cancer therapy.</p>

<p>Metabotropic glutamate receptors (mGluRs) are G protein-coupled receptors that have been divided into three groups based on sequence, putative signal transduction mechanisms, and pharmacologic properties. mGluR1 is a group I receptor. Group I mGluRs are predominantly expressed in the postsynaptic somatodendritic regions, especially in brain areas highly responsive to psychostimulants. mGluR1 is a pivotal regulator of glutamatergic neurotransmission which is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions._x000D_<br>_x000D_<br>Group I mGluRs are coupled exclusively to Gq protein (Gq/11), a heterotrimeric G protein subunit that activates phospholipase C (PLC) and regulates inositol 1,4,5-tris phosphate (IP3) receptors via association with the synaptic scaffolding protein, Homer._x000D_<br>_x000D_<br>mGluRs modulate neuronal excitability and development, synaptic plasticity and neurotransmitter release underlying optimal cognitive function. Activation of mGluR1 facilitates long-term depression of parallel fiber-Purkinje cell synapses critical for cerebellar motor learning._x000D_<br>_x000D_<br>This antibody is conjugated to Alexa Fluor® 488, a popular bright green fluorescent dye with high pH-stability.</p>

<p>The Streptococcus pneumoniae antibody is a monoclonal antibody that specifically targets and neutralizes the activity of Streptococcus pneumoniae, a bacterium that can cause serious infections such as pneumonia and meningitis. This antibody is derived from albumin, a protein found in human serum, and has been shown to have inhibitory effects on the growth of this bacterium. Additionally, the Streptococcus pneumoniae antibody has been found to interact with vasoactive intestinal peptide (VIP), a steroid hormone involved in immune regulation, and epidermal growth factor (EGF)-like proteins. This interaction may further enhance its neutralizing properties and contribute to its potential therapeutic applications in the field of Life Sciences.</p>

<p>GLG1</p>

<p>Peptide H-YPI^PPPDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>