Biochemicals and Reagents

<p>Peptide H-HLSVNDLPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anti-CYR61 antibody</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ILSPFLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ara h 1 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 1 is a member of the 7/8 S globulin (vicilin) family of seed storage proteins belonging to the cupin superfamily and is the most abundant allergen present in the peanut kernel. Ara h 1 plays an important role in the allergy sensitising procedure and can be recognised by 90% of patients with a peanut allergy.This peptide represents a tryptic peptide of Ara h 1.</p>

<p>Purified recombinant Human GALE protein</p>

<p>Peptide H-LKEFGNTLEDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FAHTVVTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PPGAEGNRTAGPPRRNEALAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Orexin A is one of two closely related peptides- the orexins (also known as hypocretins). These small neuropeptides are secreted from orexin-containing neurons, located mainly in the lateral hypothalamus (LH). Orexins function via the binding and activation of two G-protein-coupled receptors (GPCRs)- orexin receptor type 1 (OX1R) and 2 (OX2R).Orexins play several vital roles in a range of physiological activities, including: circadian rhythm, feeding behaviour, energy balance, glucose metabolism, neuroendocrine functions, stress-adaptive responses and reward and addiction. Orexins have also been linked to the pathological processes of neurological diseases such as: narcolepsy- depression- ischemic stroke- drug addiction and Alzheimer's disease.This Orexin A peptide contains two disulphide bridges, one between cysteine 7 and cysteine 13, and the other between cysteine 8 and 15. Orexin-A appears to be the isoform most important for the feeding response.</p>

<p>Peptide H-VGGNYNYLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Zeranol 16 Conjugate for use in immunoassays</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

Peptide H-DTLMISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LQHLENELTHDIITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL</p>

<p>H-VTTLGMALY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTTLGMALY-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTTLGMALY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTTLGMALY-OH at the technical inquiry form on this page</p>

<p>Ac-CPSGGSQGPSHYMARY-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CPSGGSQGPSHYMARY-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CPSGGSQGPSHYMARY-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CPSGGSQGPSHYMARY-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-VSAQQVQGVHAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-K^LVFFAEDVGSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-L^DL^SSLAYSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALDFAVGEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Benzoylecgonine antibody was raised in mouse using benzoylecgonine-BSA as the immunogen.</p>

<p>Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GQYCYELDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Mal-RSQSRSRYYRQRQRSRRRRRRS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Region of KC protein corresponding to amino acids APIANELRCQ CLQTMAGIHL KNIQSLKVLP SGPHCTQTEV IATLKNGREA CLDPEAPLVQ KIVQKMLKGV PK.</p>

<p>Peptide H-IWLTALKFLGKHAAKHEAKQQLSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LFLEPIGADIALLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>AAV2 antibody was raised in mouse using recombinant AAV-2 Rep 78 protein, N-terminally truncated by 171 amino acids, as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Bupropion is an antidepressant drug that has been used in treatment trials for major depressive disorder. It has been shown to be effective in combination therapy with other drugs, such as a serotonin reuptake inhibitor (SSRI) or a tricyclic antidepressant (TCA). The drug's mechanism of action is not well understood but is said to increase the levels of dopamine and norepinephrine by inhibiting their reuptake.</p>

<p>Peptide Ac-KENALLRYLLDKDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VNHVTLSQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The STAT3 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of the STAT3 protein, which plays a crucial role in cell growth and survival. This antibody has been extensively studied and proven to be effective in blocking the activation of STAT3 by various growth factors, such as imatinib and interferon.</p>

<p>HBcAg antibody was raised in mouse using recombinant HBcAg as the immunogen.</p>

<p>Peptide derived from GP33, an epitope of the lymphocytic choriomeningitis virus (LCMV) which produces a CD8+ cytotoxic T lymphocyte response.</p>

<p>Pigment Red 171 is a polyester that can be used as an additive to plastics. It has a molecular weight of about 400 and contains a hydroxyl group, which gives it thermal expansion properties. Pigment Red 171 also contains an aluminium skeleton that provides inorganic stability. This pigment has a basic group, which makes it soluble in organic solvents such as sulfides and alcohols. The pigment is resistant to light and radiation, which allows it to be used for protective coatings or sensors. Pigment Red 171 has functional groups for use in organic synthesis reactions.</p>

<p>Peptide H-SAPATGGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CRKQPVKEVPQFSEED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GFEAWKPSPC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GFEAWKPSPC-NH2 is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GFEAWKPSPC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GFEAWKPSPC-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-IDSLLENDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Testosterone antibody was raised in mouse using testosterone-3-CMO-BSA as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Complement C3 is a fundamental factor featured in all three complement system pathways: the classical, lectin and alternative. To activate the complement cascade C3 associates with C3 convertase to produce C3a and C3b. It is also thought that C3 can be cleaved by proteases outside of the complement cascade. C3b can bind to carbohydrate and protein hydroxyl groups through a thioester bond generated by C3 convertase cleavage. This action allows C3b to be used as a 'marker of foreign molecules such as pathogens and ultimately leads to the assembly of the membrane attack complex (MAC) and anaphylatoxin production.Overall the main functions of the complement system are to mark cells for phagocytosis, the recruitment of inflammatory cells and the cell lysis of bacteria cell by the MAC. The anaphylatoxins C3a and C5a recruit neutrophils and causes the inflammatory response while the MAC produces pores in the bacterial membrane thus causing a Ca2+ influx into the cell and bacterial cell death.The complement system as a whole can be associated with the neurological diseases, bacterial meningitis, thrombotic disorders, neurological and autoimmune diseases.The Leucine residue at position 16 of Complement C3 has been isotopically labelled with carbon-13 (6) and nitrogen-15 (1).</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-KFVAAWTLKAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-THVSPNQGGLPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Galanin is predominantly an inhibitory neuropeptide expressed in humans and other mammals' brains, spinal cords, and gut. Galanin signalling occurs through three G protein-coupled receptors. The functional role of galanin remains largely unknown- however, galanin is predominantly involved in the modulation and inhibition of neuron action potentials. Galanin has been implicated in many biologically diverse functions, including nociception, waking and sleep regulation, cognition, feeding, mood regulation and blood pressure regulation. Galanin appears to have neuroprotective activity as its biosynthesis is increased 2-10 fold upon axotomy and during seizure activity in peripheral tissues and the brain.The clinical relevance of galanin is related to several chronic neural disorders, including Alzheimer's disease, epilepsy, depression and cancer those who suffer from type 2 diabetes mellitus, depression and Alzheimer's disease often express high levels of galanin. Conversely, intervention with galanin agonists (for example, M617, M1145 and M1153) manifests anti-insulin resistance and anti-Alzheimer's disease characteristics and ameliorates or reinforces depression-like behaviour. Specifically, activation of GAL2 can alleviate such disease features in human and rodent models. This galanin (2-30) peptide has been used to characterise Galanin's binding sites and affinity for GALR receptors via competition binding analysis. Galanin (2-30) is a full agonist of the GALR2 receptor compared to its affinity for GALR1.Galanin (2-30) is provided with an N-terminal 5-FAM, a widely used green fluorescent reagent ideal for peptide labelling and detection and a C-terminal cysteine for site-specific conjugation. The excitation/emission for this reagent is 490 nm/520 nm.</p>

<p>Goat anti Rat IgG (H + L) secondary antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Matriptase antibody, catalog no. 70R-12147</p>

<p>Peptide LCBiot-RSFIEDLLFNKVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TVEGAGSIAAATGFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-LKPRRGTPEFSPLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This peptide represents the anti-microbial domain of the LL-37 peptide. LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37- this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also has anti-cancer properties and regulates many aspects of the innate immune system, overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis.</p>

<p>Peptide H-DINAYNCEEPTEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The CD40L antibody is a monoclonal antibody that specifically targets the CD40 ligand, a molecule involved in immune responses. It has been shown to be effective against various diseases, including cryptosporidium infection and certain types of cancer. The CD40L antibody binds to the CD40 ligand on immune cells, leading to the activation of immune responses and the inhibition of disease progression. This antibody can be used in research laboratories and clinical settings for studying immune system function and developing new therapeutic approaches. Additionally, it has potential applications in gene therapy, as it can be delivered using adeno-associated viruses or other delivery systems. The CD40L antibody is a valuable tool for researchers in the Life Sciences field and holds promise for future medical advancements.</p>

<p>Peptide H-LFEELVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Capecitabine is a chemotherapeutic agent that is used in the treatment of various cancers such as gastrointestinal, breast and pancreatic. This drug is a nucleotide metabolic inhibitor and inhibits DNA synthesis and slows the growth of tumor tissue. It is a prodrug of Fluorouracil.</p>

<p>Peptide H-SSVSDYVNYDIIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Fluor-RRPRSPAKLSFQFPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Z-LLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NAIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>The Glyphosate antibody is a monoclonal antibody that specifically targets and neutralizes glyphosate, a widely used herbicide. It has been shown to bind to glyphosate molecules and prevent their interaction with target proteins in plants. This antibody can be used in various applications, including research, agriculture, and environmental monitoring. The Glyphosate antibody has high affinity and specificity for glyphosate, making it a valuable tool for detecting and quantifying glyphosate residues in various samples such as water, soil, crops, and food products. Its use can contribute to the development of sustainable farming practices and the protection of human health and the environment.</p>

<p>Peptide H-GDMGDVQHFADDVIAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Recombinant Chikungunya virus Glycoprotein E1 protein - wild type</p>

<p>KLHY-[AMC]</p>

<p>Peptide Ac-SYEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5TAMRA-SGGDDDWTHLS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SVLLDAASGQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ATGIPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-KRAYYIYSGGERVPL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Endothelin-1 (ET-1) is a peptide hormone that stimulates the release of catecholamines from the adrenal medulla, and acts as a vasoconstrictor. ET-1 is a potent activator of endothelin receptor type A (ETA), which causes vasoconstriction and bronchoconstriction. The antibody recognizes human ET-1 and does not cross react with other endothelin peptides. This antibody can be used for the detection of ET-1 in tissues or cell culture supernatants. It can also be used to purify recombinant human endothelin or ET receptor subtypes.</p>

<p>Peptide H-DFSIWEETGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LANFLVHSSNNFGAILSSTNV^GSNTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>17:0-20:4Pi (4) P is a synthetic phosphoinositide, which is a type of phospholipid. It is typically sourced from laboratory synthesis, often incorporating stable isotopes or specific fatty acid chains to mimic natural compounds found in cell membranes. This product functions primarily as a probe in biochemical experiments, particularly for studying lipid signaling pathways within cells.</p>

<p>H-Ser-Leu-Ile-Gly-Arg-Leu-OH is a peptide that is derived from the amino acid sequence of the Protease Activated Receptor (PAR) and has been shown to be an inhibitor of PAR4. It has been shown to inhibit coagulation, myocardial infarct, cytosolic Ca2+, and receptor activity in vitro. H-Ser-Leu-Ile-Gly-Arg-Leu-OH has also been shown to decrease blood pressure in mice by inhibiting cyclase activity and reducing vascular reactivity.</p>

<p>Peptide H-EGPR^NQDWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Human adrenocorticotropic hormone (ACTH) also known as corticotropin. ACTH is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency</p>

<p>Please enquire for more information about CA 19-9 Positive Human Serum/K2 EDTA Plasma/Li Heparin Plasma Matched Sets including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-DDSSPGFFLKITK^NVPR^L-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AQALEQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VFIGINDLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TKD (450-463) is an immunogenic heat shock protein 70 peptide which has been labelled at the N-terminus with Cys(Npys).</p>

<p>Peptide H-ILAGPAGDSNVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Auto-inducing peptide (AIP) is a cyclic thiolactone quorum sensing peptide from Staphylococcus aureus which is responsible for activating the agr response. AIP is released from the bacteria and its extracellular concentration is then sensed by a two-component system on the bacterial surface, AgrC and AgrA. AgrC is the membrane histidine kinase receptor and AgrA is a response regulator- upon binding of AIP, AgrC phosphorylates AgrA.AIP accumulates during growth activating an AgrC and AgrA cascade when it reaches a critical signal level. This cascade activates P2 and P3 promoters which autoactivate the agr system and upregulate RNAIII transcription. RNAIII regulates the expression of virulence factors including toxins, super-antigens, and exo-enzymes. Extensive research to identify AIP:AgrC inhibitors aims to find therapeutics against pathogens.AgrD is the precursor peptide of AIP, and AgrB is an integral membrane endopeptidase essential to biosynthesize AIP. This AIP system is conserved among many Gram-positive bacteria. S. aureus strains are categorized into four groups (I-IV) according to their AIP signal and cognate extracellular receptor, AgrC.  AIP-I has the characteristic five-residue thiolactone ring with a short N-terminal extension. AIP-I has been used to generate a biosensor for the detection of S. aureus in nanomolar range for use in hospital settings.</p>

<p>Peptide 2Azido-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections and its ability to inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. This drug has been extensively studied using advanced techniques such as patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>Peptide H-ARPALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>